KEGG   Paenibacillus polymyxa SC2: PPSC2_c4195Help
Entry
PPSC2_c4195       CDS       T01335                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPSC2_c4195
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PPSC2_c4195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4413693..4415150)
Genome map
AA seq 485 aa AA seqDB search
MTKTLKGFPQNFLWGGATAANQLEGAFDVDGKGLSSADMIAYVPKAERKNDHAIEISSER
LEDILAGKVNARFPKREGVDFYHRYKEDIALFAEMGFKVFRMSIHWSRIFPNGYDAEPNE
AGLQFYDNVFDELRKYGIEPLVTLSHYETPLGLTQKYNGWLGREVVDHYVKYAETVFTRY
KDKVKYWLTFNEINVMTMSPFTGGGVVIDRVENKQQAIYQALHHQFVASALATKRGHEII
PGAQIGCMLARIESYPHTCNPEDILKAQHENQMNLFFTDVHARGEYPNYMNRYFEENNIV
IQTEPGDAEILKNNTVDFISFSYYMTLTVSAGPEGEKAAGNLIGGVKNPYLQSSDWGWQI
DPIGLRVTLNTFYDRYQKPLFIVENGLGAYDKVEEDGSVHDTYRIDYLRQHIAQMKEAIA
DGVDLIGYTSWGPIDLVSMSTSEMSKRYGFIYVDLDDDGNGTLQRSKKDSFNWYKNVIAT
NGEEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagacgctaaaaggattcccgcaaaacttcctatggggcggggcaactgcagcc
aaccaattggaaggtgcttttgacgtagatggaaaaggcctgtccagcgcagacatgata
gcctatgtacctaaggcagaacgtaaaaacgatcatgctatagaaatttcgtctgaacga
ctggaggacatcttggcagggaaggtaaacgcccgttttccaaagcgtgaaggagtggac
ttctaccaccgctacaaagaagatattgctttgtttgcagaaatgggctttaaagtattc
cggatgtccatccactggtcgcggattttcccgaatggatatgatgccgagccgaatgaa
gcaggattgcaattttacgacaatgtattcgatgagctgcgcaagtatggaattgagccg
ttggtaacattgtcacattatgaaacaccgctaggtctgacacagaagtataatggctgg
ttgggacgcgaagtcgtagatcattacgtaaaatatgccgaaacggtatttacacgctat
aaggataaagtaaaatactggctgacctttaacgaaatcaatgtcatgaccatgagtccg
tttactggcggcggtgtggttattgaccgtgtagaaaacaaacaacaagcgatatatcaa
gcattgcaccatcaatttgtagcaagtgcactggcgaccaaacggggacatgagatcatt
ccgggtgctcagatcggctgtatgctggctcgcattgaaagctacccacatacgtgtaac
ccagaggatattctgaaagcacagcatgaaaatcaaatgaacctgttctttacggatgtg
catgctcgtggggagtatcccaactatatgaaccgctattttgaagaaaataatattgtg
atccagacagaacccggcgatgctgaaattttgaaaaataatacggttgattttatctca
tttagctactacatgaccttgaccgtatcggcaggtccagaaggagaaaaggcagcaggg
aacctgattggcggtgtgaaaaatccgtatttgcaatcctccgattggggatggcagatt
gatccgatcggcctgcgtgttacactaaatacgttttatgaccgttaccaaaagccgctg
ttcatcgtggaaaatggcctgggtgcgtacgataaggtagaagaggacggctctgtgcat
gacacgtatcgcattgattacttgcgtcagcatattgcccaaatgaaggaagccattgct
gacggtgttgatctgattggttacaccagctggggtcctatcgaccttgtgagcatgtct
acttccgaaatgtccaagcgctacggatttatttacgttgatctggatgatgacggtaac
ggaacgctccaacgctccaaaaaggactcatttaactggtataaaaatgtgatagcaacc
aatggtgaagaattgtaa

DBGET integrated database retrieval system