KEGG   Paenibacillus polymyxa SC2: PPSC2_c4216Help
Entry
PPSC2_c4216       CDS       T01335                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPSC2_c4216
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PPSC2_c4216
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PPSC2_c4216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4440664..4441575
Genome map
AA seq 303 aa AA seqDB search
MTRTIRLLMPQWQGGNNPNYSFGAELLAWLAPDNDQPLIHVPVQAYDGTPLDNENGMNGR
KQLLEQLEAAQHIIDAHKPDRIVMFGGDCLVEQAPFAYLNERYGGELGLIWIDAHSDLVR
YVGYDNGHTLPLGNLLGEGDEEFAKHVKVPLKPENVFIAGLAAPTEEETKAFSETFQKLG
VTTIETDAEVIQRLGIRTAGTKELTISTESIKEWITESGIKHLAIHLDLDVLDPKSFRSL
LFANPEAPYNLSPAGTMQIPQLLHLIKELSEETDVVGLGITEHMPWDAINLKNLLGEIPI
LNN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactagaacaatacgcctcttaatgccgcaatggcaaggaggaaacaatcctaactac
tcttttggagctgaactgctggcttggctagccccagacaatgatcaaccccttattcat
gttccggttcaagcttatgatggaactccgcttgacaacgagaacggtatgaatgggaga
aaacagctacttgaacaattagaggctgctcaacatatcattgacgctcataagccagat
cgcattgtaatgtttggtggtgactgcttagtcgaacaagccccgtttgcctatttgaac
gaacgatacggtggagaattagggctaatttggatcgatgctcacagtgatttagttaga
tatgtgggctatgataacggacatacattaccacttgggaatctgttgggagaaggagat
gaggagtttgcaaaacatgtgaaagttcctcttaagcctgaaaatgtctttatcgctgga
ttagcggctcctacagaagaagagacaaaagcattttcagaaacatttcaaaaactaggt
gttactactatagaaacagatgctgaagtaattcaaagattagggattcgaactgctgga
accaaagagttaacgatcagtaccgaatcaataaaagagtggattacagaaagcggcatc
aagcacctggcgattcaccttgatttagatgtacttgatccaaaatcatttcgttcttta
ttattcgccaaccctgaagctccctataatctttctcctgcgggaaccatgcaaatacct
caactacttcatctgattaaagaactatctgaagaaaccgatgtagttgggttaggtata
accgagcatatgccgtgggatgctattaatttaaagaatctgcttggagaaatacctatt
ttaaataattaa

DBGET integrated database retrieval system