KEGG   Paenibacillus polymyxa SC2: PPSC2_c4223Help
Entry
PPSC2_c4223       CDS       T01335                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPSC2_c4223
Enzymes [BR:ppm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PPSC2_c4223
Peptidases [BR:ppm01002]
 Cysteine Peptidases
  Family C44
   PPSC2_c4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4445838..4447682
Genome map
AA seq 614 aa AA seqDB search
MCGITGFIQWNGDLMHQSELLLNMTQTLSDRGPDAAGTWISNPCAFGHRRLSVMDPENGA
QPMIRQLEDITYTIVYNGEIYNAPELKKELQQRGHFFRTQCDTEVLLESYIEWGPDCVDR
LNGIFAFAVWDSEREQVFLARDRLGVKPLFYSQTEDVFVFGSEPKALLQHPAVEAAVDAE
GLAEIFIIGPARTPGHGVYSSMKELRPGHTLTYSRDGVRIQAYWKLESIAHEDNTEETAL
KVRELLMDTVERQLISDVPVCTLLSGGLDSSALSALAVDYYKRTGQGQVHTYSVDYVDND
KHFKAHAFQPGADAPWIQRMVDELGTNHHWIEFDTPEVVAALNNSTLTRDLPGMADVDSS
LYLFCREIKKGATVAISGEAADEVFGGYPWFHREDMLNSGTFPWAVAPDMRASLLSPEVR
DWIKPLEYLNDRYSEAVGEVPKLPGETGKAAQMRVMSYLNITRFMPTLLDRKDRMSMGVG
LEVRVPYCDHRLVQYVWNIPWSIKMTGGREKGILRKALEGVLPDDVLYRKKSPYPKTHNP
SYLAAVKKQALQLLDDSSSPLLKLIDAQKVREIAASPEASTNLPWFGQLMSGPQLFAYLT
QVDNWLRTYKVAIR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattacaggtttcatacagtggaacggagacttgatgcatcaatctgagtta
ctgctaaatatgacgcaaacgctctccgatcgcggaccggatgctgcgggtacctggata
tccaacccgtgtgccttcggacaccgaagactaagcgtaatggacccggaaaacggcgct
cagcctatgatccggcagcttgaggatatcacttatacgattgtatataacggggaaata
tataacgcgcctgagctgaaaaaagagctgcaacagcgcggtcattttttccgtacacaa
tgcgacacagaggtactgctcgaatcctatatcgaatggggcccggattgtgtagatcgg
ttgaacggcatctttgcgtttgcggtctgggatagtgagcgggagcaggtatttctggca
cgagatcgcctgggagtgaagccgttattttatagccaaaccgaagatgtattcgtattt
ggctccgaacccaaagcactgctccagcatccagcggtagaggccgccgtagacgccgag
ggactggcagaaatttttatcattgggcctgcacgcacccccggacacggcgtctattca
tcgatgaaggaattgcgtcccggacataccctaacctacagccgtgacggcgtacgcatc
caagcctactggaagctggaaagcattgcacatgaggataacaccgaagaaacggcactc
aaggtacgagagctgttgatggataccgtggagcggcagcttatttcggatgtaccggta
tgtaccttattgtctggcgggctggattcaagcgccctgtccgcattagccgtcgattat
tacaaacgtaccgggcagggacaagttcatacgtattcggtcgattatgtggacaacgac
aagcattttaaagcccatgcgtttcagcccggagctgatgccccctggatacagcgaatg
gtcgatgaattagggacaaatcatcactggattgaattcgatacaccagaagttgtagca
gctctgaataactccacgctaacgcgggatttacccggaatggcggacgtggattcgtca
ctgtatctcttttgccgggagattaaaaagggcgctacggttgctatttctggtgaagca
gcagatgaagtgtttggtggatatccatggttccatcgggaggatatgctgaactcaggc
acatttccgtgggcagttgctcccgatatgagagcgagtctgctatccccagaagtgcgg
gactggatcaaaccgctggagtatttgaacgaccgctactcagaagcagtcggagaagta
ccaaagctaccgggtgaaacaggaaaagctgcgcaaatgcgcgtcatgtcttatttgaac
atcacccgctttatgcctaccctactggatcgcaaggatcggatgagtatgggggtggga
ctcgaagtacgggtgccgtattgcgatcatcggctggtgcaatatgtatggaacattccg
tggagcatcaaaatgacaggcggacgtgaaaaaggtattttacgcaaggcactggagggt
gtattgccggatgatgtgctgtatcgcaaaaaaagcccgtatcccaaaacgcataatccc
tcctatcttgccgctgtgaaaaagcaggcgctacaactgctggacgattcctcttcccca
ctgctcaagctgatcgatgcgcaaaaggtacgggagattgccgcctcaccggaggcatcc
accaatctaccttggtttggccagctgatgtcgggtccgcagttatttgcttacttgacg
caagtggataattggcttcgcacctacaaggtggcaattcgataa

DBGET integrated database retrieval system