KEGG   Paenibacillus polymyxa SC2: PPSC2_c4448Help
Entry
PPSC2_c4448       CDS       T01335                                 

Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPSC2_c4448
Enzymes [BR:ppm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PPSC2_c4448
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPSC2_c4448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4659574..4661115
Genome map
AA seq 513 aa AA seqDB search
MNIETYILAIDQSTSGTKTLLVNQQGDVITRYSLEHKQYYPQPGWVEHDPLEIYHNVLIA
AKGVLEKAGLSPSSLAAVTITNQRETALIWDRSTGLPIYNAIVWQCQRTAEVYTRLKNTG
YEDVIRSKTGLMLDPYFSAAKFNWILEHVPHASQLLAEGKLLAGTIDSWLLWKLTGGQIH
ATDYSNASRTSLFNIHTLAWDMDLCSIFGVPSSILPEVKASDALYGYTQEAELWAEQVAI
SGIIGDSQGALYGHRCFETGDAKATYGTGTSVLMNIGSQPVQGGDGLVTTIAWGASGKIT
YALEAVIRTTGDSIKWTRDNLGLFSSFEEMQSMITELQDNEGVYLIPAFVGLGAPYWNPS
ARAAIVGMTRGNGKAHIVRAALESIGYQVRDAVEFIREQSGVPLTSLRTDGGASSNSWLM
QFQADILGTHVTRSTCAELSAMGSVYLGGLGVGYWSDSKSIVTGNTSDQNLYEHYTPSMD
EVRRQRLYTGWQNAVQMVIRSDQPLTSSSSANC
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgagacctatattctggcgatcgatcaaagcacttctggaaccaaaactctg
ctggtcaatcagcagggcgatgtgattacccgttattctttggagcacaaacaatattac
ccacagccgggctgggttgaacatgacccgcttgagatatatcacaatgtgcttattgct
gcgaaaggcgtactggagaaagccggactttctccctcctcgctggccgcagtaacgatt
acgaatcagcgagaaacggctctgatctgggaccgttctactggcttgcctatctataat
gccattgtatggcagtgccagcgaacggcagaggtctacacacgcttgaagaatactggc
tatgaagatgttatacgctccaagacaggtctaatgctcgatccttatttctctgccgcc
aagttcaattggattttggaacatgtacctcatgcctcccaattgcttgctgaaggtaaa
ctacttgcggggaccattgacagctggctgctatggaaacttacaggcggtcaaatacat
gcaaccgattacagcaacgccagccgtacttccctttttaacattcacacgctggcttgg
gatatggatttgtgcagtatatttggtgtgccttcctccatactccctgaggtaaaagca
tccgatgccttgtatggctatacacaggaagcggaattatgggccgaacaagtagctata
tcaggcataatcggagattcacagggtgcactgtacggacaccgttgcttcgagactggc
gacgccaaagcgacatatgggactggaacatctgtacttatgaatattggttcgcaaccc
gtgcagggcggtgacggcctggtcacaacgattgcctggggggcttcaggaaagattact
tatgcattggaagccgttatacgtacgaccggagacagtataaaatggacaagggataat
ttaggattattctcgtcatttgaggaaatgcaatccatgatcaccgaattgcaggacaat
gagggcgtatatctgatccctgcttttgttggtttaggtgctccctactggaatccctct
gcacgtgctgcaattgtgggtatgacccgtggaaacggcaaagcacatattgtgcgcgca
gcgctggagagtatcgggtatcaagtgagagatgcggtagaatttatacgtgaacaatcc
ggtgtaccccttactagtttacgtacagatggcggggcctcatctaacagctggctcatg
cagtttcaggcagatattttgggtacccatgttacccgctctacctgtgccgagctgtct
gcaatgggctctgtgtatctgggcggtcttggagtcggatactggtcagattctaaaagc
atcgtcacgggaaacacctctgatcagaatctatatgagcactacactcctagtatggat
gaagtcaggcgccagcggctttatacaggttggcaaaatgctgtgcagatggtaatacgt
tcagaccaaccgcttacatcatcttcttccgctaactgttga

DBGET integrated database retrieval system