KEGG   Paenibacillus polymyxa SC2: PPSC2_c4708Help
Entry
PPSC2_c4708       CDS       T01335                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ppm  Paenibacillus polymyxa SC2
Brite
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PPSC2_c4708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4929094..4929732)
Genome map
AA seq 212 aa AA seqDB search
MFKFSKKMLTVVLAASMSFGVFATTSSAATDYWQNWTDGGGTVNAVNGSGGNYSVTWKDT
GNFVVGKGWTTGSPNRTINYNAGVWAPSGNGYLALYGWTRNALIEYYVVDSWGTYRPTGT
YKGTVTSDGGTYDIYTTMRYDAPSIEGQKTTFIQYWSVRQTKRPTGGNSTITFSNHVKAW
ASKGMHLGNNWSYQVLATEGYQSSGSSNVTVW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttagtaagaaaatgttaacggtagttcttgcagcttccatgagttttgga
gtgtttgcaacaacctcaagtgcagcgacagactactggcaaaattggaccgatggcggc
gggaccgtcaatgctgttaatggatcaggcggtaattacagcgtaacatggaaggatacc
gggaattttgttgtcggcaaaggctggactactggatcgcccaacagaacgattaactac
aatgccggtgtctgggcgccgtccggtaatggatatttggctctctacgggtggacgaga
aacgcactcatcgaatattacgtcgttgatagctggggtacttatcgacctaccggaacg
tataaaggtacagtgaccagtgatgggggcacatatgacatctacacaacaatgcgatac
gacgcaccttccattgaaggccaaaaaacgacgtttattcagtactggagtgttcgacag
acgaagagaccgaccgggggcaactccacgatcactttcagcaatcacgtgaaggcatgg
gcgagcaaaggaatgcatctggggaacaactggtcttaccaggtgttagcaacagaagga
tatcagagtagtgggagctctaacgtaacggtgtggtaa

DBGET integrated database retrieval system