KEGG   Paenibacillus polymyxa SC2: PPSC2_c4901Help
Entry
PPSC2_c4901       CDS       T01335                                 

Definition
dtdp-4-dehydrorhamnose 3,5-epimerase like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PPSC2_c4901
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPSC2_c4901
Enzymes [BR:ppm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PPSC2_c4901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5177020..5177553)
Genome map
AA seq 177 aa AA seqDB search
MIFTETVLSGVYLIGLELLTDVRGHFARAWCQDEFKSHGLECSFVQCNISYNEKKGTLRG
LHYQAPPYEEVKIVRCTKGSIYDVIVDLRPDSPTYKQWLSIELSDKNYKMLYIPKGFAHG
YQTLSDNTEVFYQVSQMYKAEYARGVKWDDPEFNIEWPEEEKRIMSEKDQNCDRYRS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatatttacggaaactgtattatcaggggtgtatttgatcggattagagctattaact
gatgtgcgaggacattttgccagagcctggtgccaagatgagtttaagtcacatggtctg
gagtgttcattcgttcaatgtaatatctcttataacgaaaaaaaaggaacactgcgggga
ttacattatcaggcacctccctacgaagaagtgaaaatagttcgttgtacgaaaggatct
atttatgatgttatcgttgatttgaggccagattctccaacttataaacagtggctttct
attgagttgtcagataaaaattacaagatgctctacatacccaagggtttcgcacatggt
tatcaaacattgtctgataatacggaggttttttatcaggtgagccagatgtataaagcg
gaatatgcccgcggagtaaaatgggatgatcctgaatttaatatagaatggcctgaagaa
gaaaagagaattatgtcagaaaaagaccagaattgtgacaggtatcggtcatga

DBGET integrated database retrieval system