KEGG   Paenibacillus polymyxa SC2: PPSC2_c5008Help
Entry
PPSC2_c5008       CDS       T01335                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppm00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppm00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5290011..5290487)
Genome map
AA seq 158 aa AA seqDB search
MSVYSYNAVTPANQEVSLETYTGKVLVIVNTASKCGLTPQYGDLQKLYDEYKDRGLVVLG
FPCNQFGGQEPGSSEEAAEFCQLNYGVNFPVFAKVDVNGPDTAALFEYLKKQQPGEQEDG
TIQWNFTKFIVNREGVPVGRFEPKESPEAMKAAIEQLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctattcatataatgctgtaacaccagccaatcaggaggtttctctggaaact
tacacaggtaaagtgctggttattgtgaataccgccagtaagtgcggacttaccccgcaa
tatggggatttgcagaagctttatgacgaatataaggatcgagggctcgttgttttaggc
ttcccttgcaaccaatttggcggtcaggagccgggcagcagcgaggaagcggctgaattt
tgccaattgaattacggggttaatttcccggtattcgccaaagtggatgtgaacggaccg
gatacagcagctctgtttgaatatttgaagaagcagcagcctggagaacaggaagatggt
acaattcagtggaattttacgaaattcattgtgaatcgtgaaggtgtgcctgtggggcgt
tttgagcctaaggagtcaccggaagcgatgaaagctgccattgagcagttgttataa

DBGET integrated database retrieval system