KEGG   Paenibacillus polymyxa SC2: PPSC2_c5053Help
Entry
PPSC2_c5053       CDS       T01335                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPSC2_c5053
Enzymes [BR:ppm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PPSC2_c5053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5334097..5334954)
Genome map
AA seq 285 aa AA seqDB search
MAQRMAGKRVALAGPRKAEEMALLVMKMGGEPVERPAQGTVFLDDIELRNAVVSWVKNPP
DWYIFTTGMGLDALFDMAEDMGVAEQIIELLQSSNIAARGYKTVNGLKKRGFTPAVRDED
GSLIGLTRAFAPYDLKGKEVLLQLHGDPAPRLVEWLDEQGAVTRQVLPYKHIPPEEAKLQ
ALLDDVINRTIDAVTFTSGPQIRFLAQYAREQNRFEDLLEAFREDVIAVSVGKVTAQSIL
EEGIERIVFPTEERMGAMMVELGKYFEHSDSVHGCGLKSVNGHLK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgcatggcaggtaagagagtcgctcttgccggtccccgtaaagcagaagaa
atggcactgctagttatgaagatggggggcgagccagtagagcgtccggcccaggggact
gtttttctagatgatatcgagctgcgcaacgctgttgtatcatgggtgaagaaccctccg
gactggtacatcttcacgaccggtatgggactggatgctctgttcgatatggcggaggat
atgggcgtggccgagcagattatagagctgctgcaatcctccaacattgcagcacggggc
tacaagacggtcaatggactcaaaaagcgtggctttacgccagcagtacgggacgaggac
ggaagtttgatcggattgacacgggcctttgccccatatgatctgaaggggaaggaagtg
ctgttgcaactgcatggagacccggccccccggttggtagagtggctggatgagcagggc
gcagtgacccgccaagtacttccttataagcatatcccacctgaagaagcaaaattgcag
gcgttactagatgatgttataaaccgtacgattgatgccgttacgttcacgagtggcccg
caaatccgatttttggcccaatatgccagagagcaaaatcgatttgaggatttactggaa
gcttttcgtgaagatgtaattgctgtatcggtaggcaaggtgaccgcacaatccattttg
gaagaagggattgaacgaatcgtgtttccaactgaagagcgcatgggtgcgatgatggtg
gagctgggcaaatattttgaacatagtgattcggtgcatggctgtggtctgaagagcgtg
aacggtcatttgaaatga

DBGET integrated database retrieval system