KEGG   Paenibacillus polymyxa SC2: PPSC2_c5129Help
Entry
PPSC2_c5129       CDS       T01335                                 

Definition
glycerol kinase (ATP:glycerol 3-phosphotransferase) (glycerokinase) (gk)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppm00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5407418..5408911)
Genome map
AA seq 497 aa AA seqDB search
MTEQYILALDQGTTSSRAILFNRQGKVVYKAQREFPQYFPQPGWVEHNANEIWSSILAVI
ASCLSESGVKASQIAGIGITNQRETVVVWDKHTGLPVYHALVWQSRQTAGICEDLKSRGL
DQTFHSKTGLLIDPYFSGTKVKWILDNVEGARAQAERGELLFGTIDTWLIWRLSGGKAHV
TDYSNAARTLMYNIYELKWDEELLDILGVPASMLPEVRSSSEIYANTVDYHFFGQEIPIA
GAAGDQQAALFGQGCFDKGMIKNTYGTGCFMLMNTGNEPCESKHGLITTIAWGLNGQVKY
ALEGSIFVAGSAIQWLRDGLRMFREAKDSEAYAARVTSTEGVYFVPAFVGLGSPYWDSDV
RGATFGLTRGTSKEHFIRAVLESLAYQTKDVLTAMASDSGVPVHSLRVDGGAVMNEFLMQ
FQSDILDLPVERPAVNETTALGAAYLAGLAVGFWDSLDEVRGYAQSDRTFTPTMSEDVRA
ERYGGWKKAVHAAMSFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagtacattcttgccttggatcagggcacaaccagttcgcgggccatctta
tttaaccggcagggaaaagtagtgtacaaggcacaacgggagttcccgcagtattttccc
cagccgggatgggtggagcacaacgcgaatgaaatatggagctctattttggccgtcatc
gcctcctgtctgtcggaatcaggtgtgaaagccagccaaattgctggaattggtattacc
aatcaacgggaaactgtggtggtgtgggataaacatacaggcctgccggtatatcatgcg
ctggtatggcagtcacggcaaacagccgggatttgcgaggacttgaaaagccgtgggctt
gatcaaacatttcatagcaaaacaggcctactcattgatccctacttttcgggtaccaaa
gtcaaatggatactcgacaacgttgaaggagcgcgagcccaggcggagcgtggagagctg
ttgtttggtacaatcgatacctggctgatctggagactgtctggcggtaaagcgcatgta
acggactattccaacgctgctcgtacgctaatgtacaacatttatgagctgaaatgggat
gaggagctgctggatattctcggcgttcctgcgtctatgctgccggaggtgaggtcatcc
tccgaaatatatgcgaatacggtggattatcatttttttggacaggaaattcccattgcc
ggagcggcgggcgatcagcaggcagctctgttcggtcagggatgctttgacaaaggcatg
attaaaaatacatacggtacgggatgctttatgctgatgaataccggaaatgaaccctgt
gaatcgaagcatggactgattacgaccattgcatgggggttgaacggtcaggtgaagtat
gcgttagagggcagcatttttgtagccgggtctgctattcagtggctgcgtgacggattg
cgcatgttccgcgaggccaaagatagtgaagcgtatgcagcgcgggtgacctcgacggag
ggggtatattttgtcccggcttttgtagggcttggcagcccgtattgggatagcgacgtg
cgcggcgctacctttggcttgacacggggaacgtccaaggagcattttatccgagcggta
ctggaatcgctggcctaccagaccaaagatgttctaaccgccatggcgagcgattcgggt
gtacctgtgcattcattgcgtgtagatgggggcgcagtgatgaacgagttcctgatgcag
ttccagagcgatattctggatctgcctgtggaacgacctgctgtgaacgagacaacggcg
ctaggggcagcgtatttggcagggctggcagttggattttgggacagtctggatgaagtc
cgggggtatgctcaaagtgatcgaacctttactccaaccatgagtgaagatgtgcgggct
gaacgatatggtggctggaaaaaggcggtccatgccgcaatgtcgttcaagtaa

DBGET integrated database retrieval system