KEGG   Paenibacillus polymyxa SC2: PPSC2_c5245Help
Entry
PPSC2_c5245       CDS       T01335                                 

Definition
beta-glucosidase a (gentiobiase) (cellobiase) (beta-d-glucoside glucohydrolase)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5536425..5537849)
Genome map
AA seq 474 aa AA seqDB search
MNHTEMKDTEQQAIQYCFPSDFWWGSSASATQTEGTVEGDGKGPNIWDYWFEQEPNRFYD
GVGPGDTSRFYTRYKEDIALMKELGHNSFRFSISWSRLFPAGRGELNQKAVQFYNAVIAE
LHEAGIEPFVNLYHFDLPMALQEKGGWVNRETVEAYVDYTNTCFELFGDRVAKWFTHNEP
IVPVEGGYLYDFHYPNEVDFGKAVQVGYHTLLSSASAIKAYKEGGYKGKIGIILNLTPTY
PRSQHPADVQAAEICDAFFNRSFLDPSVTGEFNPLLVKLLRQEGFVPNMEDGDREIIRQG
TVDLLGINYYQPRRVKARESLPNPDAPFVPERFFDYYAMPGRKMNEMRGWEIYEKGIYDI
LTNVRENYGNIECFISENGMGVQGEEKFRDENGMIHDDYRIDFIREHLKWVQRAISEGSN
VKGYHLWTFMDNWSWTNAYKNRYGFVSVDLQNEGKRSVKQSGHWFKQVIENNGF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcataccgaaatgaaagatacagagcagcaagccattcaatactgttttccatcc
gacttctggtggggctcatcagcctcggcgacccagacagaaggaaccgtggagggagac
ggaaaaggaccgaacatctgggattattggtttgaacaggagccaaaccgtttttatgac
ggggtgggacctggcgatacatcccgcttctatactcgttacaaagaagatattgcactc
atgaaagagcttggccataactccttccggttctccatttcctggtcacgcctgtttcca
gcaggaagaggtgaattgaaccagaaggcggttcaattctataatgccgtcattgcagag
ttgcatgaggcggggattgagccgtttgtgaatctgtatcattttgatttgccgatggct
ttacaggaaaaaggaggctgggtaaaccgggagacggtcgaagcttacgtggattacact
aacacttgctttgagctattcggggatcgtgtagccaaatggtttacacataacgagccg
attgtcccggtggaaggcggctatctgtacgatttccactatccaaatgaagtggatttc
gggaaagctgtacaggtgggatatcataccctgctatcgagcgcgagtgccattaaggct
tacaaagaaggcggttataagggcaaaattggtattattttgaacctgacgccaacttat
ccgcgtagtcagcaccctgcagacgtgcaggctgctgaaatatgcgatgcgttctttaac
cgttcctttttagacccatctgtgacgggagaatttaatcctttgctcgtaaagttgtta
cgccaagagggattcgtaccaaacatggaagacggagaccgggagattatacgtcaaggc
actgtggacctgctggggattaactattatcagccgcgcagagtcaaggctcgcgaaagt
cttccgaatccagatgcgccttttgtgccggaacgattcttcgattattacgccatgcct
ggtcgtaagatgaatgagatgcgaggctgggagatttatgagaagggcatttacgacatt
ctgaccaacgtcagggagaattatggaaacattgaatgcttcatatcagaaaacggaatg
ggtgttcaaggcgaggaaaaattcagggatgagaacggcatgatccatgatgactatcgc
attgattttatccgtgagcatctcaaatgggtccaacgtgccatctcagaaggctccaat
gtaaaaggttatcacttatggacatttatggacaactggtcctggacgaacgcttataaa
aatcgctatggcttcgtatctgtcgaccttcagaacgaaggcaaaagatccgttaaacag
agtgggcactggttcaagcaagtgatcgaaaataacggattctaa

DBGET integrated database retrieval system