KEGG   Paenibacillus polymyxa SC2: PPSC2_p0130Help
Entry
PPSC2_p0130       CDS       T01335                                 

Definition
Helicase RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSC2:131719..133968
Genome map
AA seq 749 aa AA seqDB search
MVEGKETIHAKFEIKKIRKHYEDTGYTIAEAKFTAYPASNAPTSELIIVGNFVSIFEGDE
FEAEGRWVNHNVFGYQFKVELPKRIVPQTQKGIEMFIRKYVKGIGKKTAQKIVDYFGEEA
LKRIEEDHRSLLQVGGISEVRAKAIQDKLFKHKRFEDVGTFVLSNGGNHKVALRIYEEFG
EASIMKIQENPYILCAIEKVGFIIADKFSRNLSGSYRNQERIKESIIYFLNWCSKSRGDL
YVSGEEIRTRLSDFLLKVGAYEGEKYRLVESDIEPALHELKSQDRIVIETNEKGVQCVYL
NNNHFVENKIVSLLKNLVEKPKPPLCTALDIDRFIEQYETTYDFKFAKKQKSAIHMALLH
GISILTGGPGTGKTQTINSIIQCLKQVKPGAVIHLFAPTGKASKRMSELTGMEAMTIHRG
IGLGHDEDSDREIIVEGDLLVIDEISMMDAYVCYRLLSSVHENTRVLFVGDYEQLPSVGP
GLILRDLINSKKIPTTRLTEIFRQAQNSQIVMNSHRIINGDIESLTFDERKGDFFFIERS
NRIQAQQTIIECVKRFVTNHHYKLDDIQILTPMRKGDLGVWSLNRLMQKTFNPPSHDKAE
IKLDELNVLREGDRVIHTVNNKDLEVFNGEVGRIIKIWEDADDGLQVEIEYDEKSVVYDK
LCIEEVELAYVTTIHKSQGSEYPVVIMPIHSSQENMLTKNLIYTGWTRAKQKVVNIGMKS
SLKVAALNEDNVRNSQIEEKVRKEINVAA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagggaaagaaacgatacatgccaaatttgagataaaaaaaattcgcaaacac
tatgaagatacgggttataccatcgccgaagcaaaattcacagcgtatccagcttcgaat
gcacctacttcggaacttatcattgtagggaactttgtttctatatttgagggagatgaa
tttgaagcagagggcagatgggttaatcataatgtctttggttatcaattcaaagttgaa
cttccaaaacgaattgttcctcaaacccaaaaagggattgagatgtttatccgaaaatat
gttaagggaattggaaagaaaacggctcagaagattgtcgattattttggggaagaagca
ttaaaacgaattgaagaggatcatcgaagtttgctgcaagtgggcgggatcagcgaggtt
cgggcaaaggcaatacaggataaattatttaaacataaacgttttgaggatgtaggtact
tttgtattaagcaatgggggaaatcataaggttgctttgcggatctacgaggaatttggc
gaagcttccattatgaaaatccaagagaatccttatattttatgtgcaatagaaaaggtc
ggttttatcattgcagacaagttctctcgaaacttgtctggttcgtatcgaaaccaagaa
cgcattaaagaatcgatcatttactttctgaattggtgttcaaaatcaagaggagatttg
tatgtttcaggtgaagagattcgaacccgattgtctgatttcttattaaaggtaggagcg
tatgagggagagaaatatcgtttagtagagagcgatattgaaccagctctacatgaactt
aaatcgcaagatcgaattgtcatcgaaaccaatgaaaaaggtgttcaatgtgtatatcta
aacaataatcactttgtagaaaataagattgtatcacttttgaaaaatctggtggaaaaa
ccgaagccaccgttatgtacagcgttggatattgatcgatttattgaacagtatgaaaca
acttatgactttaagtttgccaaaaaacaaaaatcggcaattcatatggcattactccat
ggaatcagcattttaacgggtggaccaggtacgggaaagactcaaaccattaactcgatc
atccaatgcttaaaacaggtaaaaccaggagctgtaatacacttgtttgcccctacaggc
aaggcttccaaacgcatgtctgaattaacaggtatggaagccatgacgatacataggggg
attggattagggcatgatgaagattcagatcgagaaattattgtcgaaggtgatctgctg
gttatagatgaaatttcaatgatggatgcttatgtgtgttatcgattgttgtcttcagtc
cacgagaatacgagagtattatttgttggagactacgaacaattaccttccgttggtcct
ggtttaatactgcgcgatttaattaactcaaaaaaaattcctacgactcgtttaactgag
atttttagacaagcacaaaatagccaaattgtcatgaattcacatcgtattataaacggt
gacattgaatcccttacattcgatgagcgtaaaggagacttcttctttattgaacgttcc
aatagaatccaagcgcaacaaaccattattgagtgtgtaaagcgctttgtgactaatcac
cactacaaactggatgatatccagattctaacgcctatgcgaaaaggcgatttaggggtt
tggagtcttaatcgtttgatgcaaaaaacgtttaatccaccttcgcacgataaagctgaa
atcaagcttgacgagctgaatgttctacgtgaaggcgatcgggtcattcatacggtgaat
aataaagatttagaagtgttcaacggtgaagtcggaagaatcattaagatctgggaagat
gctgatgatggtcttcaagtagagattgaatatgatgaaaaaagcgtagtgtatgacaag
ttatgcattgaagaagttgaacttgcctacgtaacaacgattcacaagagtcagggtagt
gaatatccagttgtcattatgccgattcattcttcccaggaaaatatgcttaccaagaat
ctaatttatacaggatggacgagagcaaaacaaaaggtggttaacatcggcatgaaatct
tcacttaaagtagcagcccttaatgaagataatgtgcgtaattctcaaattgaggaaaaa
gtacgaaaagaaattaatgttgctgcgtag

DBGET integrated database retrieval system