KEGG   Paenibacillus polymyxa SC2: PPSC2_p0226Help
Entry
PPSC2_p0226       CDS       T01335                                 

Definition
Helicase, RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPSC2_p0226
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PPSC2_p0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSC2:207644..210184
Genome map
AA seq 846 aa AA seqDB search
MGFASWFNKESSFSSNMNNQPDWLESLAVNEEVNCKVVVLYRKFHSEETGFSVYVCEDEN
GDVFTLSGTFAIELMDEQTYFIKGTVAIYRKEKQVTIKSARLERPTSRKGIISFLKTLKG
LNTRSEQLYDLYGEEIVEILINDPMRIAKEVSGIGKKSVESWSAQLQLLEEDYHVLSELL
AWGISMRQAKKLLERFHGQIIALIERNPYMLMNEVKGFGFLRCDEIARQVGYDPKGEERI
QQGLLYVLKEAMNEGHCFLPREMLLKRAKDCLDFKLTVIEMKQLVDRNRGVVEVPYSFGE
KTYLIPYSTLYNHWNHYQRESSARGREKYRYRVISLDIVEIEQQLLTLQSNMKIVMEKDS
VYLIYLHQAELKVADKIIRLMLENQNTFEGVQDDVERYLETNELTLEDMQKKAVEEFVSK
TGGMYILNGSAGCGKTFTLKVILALMEQQYKKRKKPFRVKIFAPTGKASKVAKKATGREC
TTVHRGLAYVRGVGFQYNEDNPLEADCVVIDESSMLDILLTSSLFEAIPAGCKVIFMGDT
KQLPSVGAGNVLYDLIECGMIPVITLNVVKRQADHSGIIRNANKIINAEMISSCQDTEDA
YVIWKHKVDDVHDTLIRSIERLMSGAKYSFEDIQILCPQRIGEIGTYVVNWMIQQAFNAD
PIGEKVLNRYIKKKLSSSKDPVDIPLYFQAGDKVIHIANNYSMPWYQKDPSGNLVEDSSL
MGITNGECGVIEEIRKEKVMNVNQTMMIVRYEDGYVQYTDNFEELDHAYALTVHKSQGSQ
WPAVIMPVMMENYNMLDNSIFYTGYTRSVDFNCVIGQPEAIAHAIRTFKNRRRFTSLKER
FLAEAS
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
ttgggatttgcaagttggtttaacaaagaatcttcgttttcgagtaatatgaataaccag
ccagattggttagaatcgcttgcagtgaatgaagaggtgaactgtaaggttgttgttttg
tatcggaaatttcatagtgaggagactggattctctgtttatgtttgtgaagacgaaaat
ggcgatgtctttacactttcgggtacgtttgcgattgaactcatggatgaacaaacatat
tttattaaagggacagttgctatctatagaaaagaaaagcaggttacaatcaagtctgcg
cgtttagaaagacctacgtctcgaaaaggtattatatcttttttgaaaacgctcaaaggg
ctcaatacgagatcagaacagttatacgatttgtatggcgaagaaattgttgaaatctta
atcaatgatccaatgcgaattgctaaggaagttagtgggattggaaagaaaagtgtcgag
agctggagtgctcagcttcagttgttggaagaggattatcatgtattgagtgagcttctt
gcttggggaatatcgatgcgccaagccaagaagttgcttgaacgttttcatggtcaaatc
attgccttgattgaacgtaatccctatatgcttatgaatgaagtaaaaggttttgggttt
ttaagatgtgatgaaattgctcgccaagttggatatgatcccaaaggggaagaacgaatt
cagcaaggacttttgtatgtcttgaaagaagctatgaatgagggtcattgttttttgcca
agagaaatgctgctgaaaagagcgaaggattgtttggactttaaacttacggttattgaa
atgaaacaacttgtcgatcgtaatcgaggcgttgttgaggttccttattcttttggtgaa
aagacctacctgatcccttattcaactttatacaatcattggaaccactatcaaagagaa
tcctctgccagaggacgagagaaatatcggtaccgtgtcatttctttagatattgtagag
attgaacaacaactattaacattgcaatcaaatatgaaaatcgttatggagaaagactct
gtataccttatttacttacatcaggcggaattaaaagtagccgataaaattatccgattg
atgcttgaaaaccagaatacatttgaaggtgttcaagatgacgtcgaacggtacttagaa
accaatgaacttaccttggaagacatgcagaaaaaagcagttgaagaatttgtgagcaaa
acgggcggtatgtacattttaaacgggagcgcgggttgcggaaaaacgtttaccctaaaa
gtcatcctggcactcatggagcaacagtacaaaaagaggaagaagccttttcgtgttaaa
attttcgcacctacgggaaaagcctccaaagtggctaagaaagcgacaggaagagaatgt
acaaccgttcatagaggtttagcgtatgttcgaggtgttggttttcaatataatgaagac
aaccccttggaagccgattgtgttgttattgatgagagttctatgcttgatattttgctt
acgagtagtttgtttgaggcgatccctgcgggttgtaaagtgatatttatgggagatacg
aagcaacttccttctgtgggtgcgggcaatgtgctatacgatttgattgagtgtggaatg
atccctgtcattacgttgaatgtagtgaagcgtcaggctgatcattcgggtattatacgt
aacgccaataagattatcaatgcagaaatgatctcttcttgtcaagataccgaggatgcg
tacgttatttggaagcacaaggttgatgatgtacatgatacacttatccgatctatagag
cgtttaatgagtggggctaaatactcatttgaagatattcaaattctttgccctcagcgc
ataggtgagatcggaacttatgtggtaaattggatgatacagcaagcatttaatgcagac
cccataggggaaaaagtattaaaccgctacatcaaaaagaagctttcttccagcaaggat
cctgtggacattccactttactttcaagctggggataaggtgattcacattgcaaataat
tactcaatgccttggtatcaaaaagatccatcgggtaacttggtagaggattcaagtctt
atgggtataaccaatggagaatgcggagtcattgaagaaattcgaaaagaaaaagtaatg
aatgtgaatcaaacaatgatgattgtccgctatgaagatggctatgtgcagtacacggat
aactttgaagaattggatcatgcatatgcattaacggttcataaaagccaaggctcgcaa
tggcctgccgttataatgcccgtgatgatggagaactacaatatgcttgataacagtatc
ttctatacagggtatactcgctctgtagactttaactgcgtcattggtcaaccggaagct
attgctcatgctattcgaacatttaaaaatagaagacggtttaccagtctgaaagaaagg
tttctcgcggaggcaagctaa

DBGET integrated database retrieval system