KEGG   Paludibacter propionicigenes: Palpr_0061Help
Entry
Palpr_0061        CDS       T01362                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00480  Glutathione metabolism
ppn00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Palpr_0061
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Palpr_0061
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Palpr_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC DUF4174
Motif
Other DBs
NCBI-ProteinID: ADQ78223
JGI: Palpr_0061
UniProt: E4T0U8
Position
complement(55519..56073)
Genome map
AA seq 184 aa AA seqDB search
MKHYSIILCLLLIGAFSTKAQEKSTSTDFYSFKSTNIQGQNVSMKAFKGKVVLIVNTASK
CGYTPQYEGLEKLYKTYKNRGLVILGFPCNQFGNQEPGSAEEIAKFCTLKYDVTFPMFMK
IDVNGENADPLYKYLKASLPDNGTGDIKWNFTKFLLDKNGKPIKRYASAIKPEELAADIE
KLLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattattcaattattctatgcttattattgataggtgcattttccacgaaagca
caggaaaaatcaacttcaacagatttttacagtttcaaaagcactaatatacagggccag
aatgtaagtatgaaagcctttaaagggaaagtagtactaatagtcaatactgccagcaaa
tgtggatatacgccgcaatacgagggacttgaaaagctgtacaaaacttacaagaacaga
ggattggttattctgggatttccatgcaaccaatttggcaatcaggaaccgggtagcgct
gaggagatcgcaaagttttgcacattaaaatatgatgttactttccccatgttcatgaaa
atagatgtaaatggcgaaaatgcagatccgctctacaaatatctgaaggcttcattgccc
gataacggaaccggggacataaaatggaatttcactaagtttctacttgacaaaaacgga
aaaccgattaaaagatatgcctctgccatcaaacctgaagaactggcagcagacatagag
aaactattactctga

DBGET integrated database retrieval system