KEGG   Paludibacter propionicigenes: Palpr_0061Help
Entry
Palpr_0061        CDS       T01362                                 

Definition
peroxiredoxin (EC:1.11.1.15 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppn  Paludibacter propionicigenes
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppn00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(55519..56073)
Genome map
AA seq 184 aa AA seqDB search
MKHYSIILCLLLIGAFSTKAQEKSTSTDFYSFKSTNIQGQNVSMKAFKGKVVLIVNTASK
CGYTPQYEGLEKLYKTYKNRGLVILGFPCNQFGNQEPGSAEEIAKFCTLKYDVTFPMFMK
IDVNGENADPLYKYLKASLPDNGTGDIKWNFTKFLLDKNGKPIKRYASAIKPEELAADIE
KLLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattattcaattattctatgcttattattgataggtgcattttccacgaaagca
caggaaaaatcaacttcaacagatttttacagtttcaaaagcactaatatacagggccag
aatgtaagtatgaaagcctttaaagggaaagtagtactaatagtcaatactgccagcaaa
tgtggatatacgccgcaatacgagggacttgaaaagctgtacaaaacttacaagaacaga
ggattggttattctgggatttccatgcaaccaatttggcaatcaggaaccgggtagcgct
gaggagatcgcaaagttttgcacattaaaatatgatgttactttccccatgttcatgaaa
atagatgtaaatggcgaaaatgcagatccgctctacaaatatctgaaggcttcattgccc
gataacggaaccggggacataaaatggaatttcactaagtttctacttgacaaaaacgga
aaaccgattaaaagatatgcctctgccatcaaacctgaagaactggcagcagacatagag
aaactattactctga

DBGET integrated database retrieval system