KEGG   Paludibacter propionicigenes: Palpr_0063Help
Entry
Palpr_0063        CDS       T01362                                 

Definition
peroxiredoxin (EC:1.11.1.12 1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppn  Paludibacter propionicigenes
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Palpr_0063
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Palpr_0063
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Palpr_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(56591..57076)
Genome map
AA seq 161 aa AA seqDB search
MNTNFHQFTATSLQGKEIAMVDYKDKVIIVVNTASKCGLTPQYEGLEKLYKDYKDKGLVI
LGFPCNQFGKQEPGTEKEISEGCLINYGVSFPMFSKIEVNGKNTHPIYAYLKKELKGTFG
NNIKWNFTKFIIDKNGNPYKRFAPVTTPEKLRKHVEDLLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaattttcaccaatttacagcaaccagcctacaaggcaaagagattgccatg
gttgactacaaagacaaagtaataatagtagtaaacaccgccagtaaatgtggacttacc
ccacaatacgaaggtcttgaaaaactctacaaagactacaaagacaaaggattagtcatt
ctgggttttccttgcaatcaattcggaaagcaggagccgggaacagaaaaagagatttcg
gaaggctgtttaatcaattacggagtgtcgttccctatgttttctaaaatagaagtcaac
ggtaaaaatacccaccccatttatgcctacttgaaaaaggaattaaaaggaacttttggg
aacaatatcaaatggaatttcactaaattcatcattgacaaaaatggaaatccgtacaaa
cgctttgcccctgtcacaacgcccgaaaaactacgcaaacacgttgaagacctgttgaag
aaataa

DBGET integrated database retrieval system