KEGG   Paludibacter propionicigenes: Palpr_0069Help
Entry
Palpr_0069        CDS       T01362                                 

Definition
glycoside hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppn  Paludibacter propionicigenes
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(63204..65564)
Genome map
AA seq 786 aa AA seqDB search
MNRKIIGLLIILLTANNYIFPLTPTSADLSNSFHAGKNEFMLNGKPYIIRAGELHYTRIP
KAYWDHRIKMCKAMGMNTICIYLFWNIHEQTPGVFDFKGQNDVAEFVRLIQQNGMYCIVR
PGPYVCAEWDMGGLPWWLLKKKDLQVRSLSDSYFMEQTKKYLNEAGKQLAPLQIQNGGNI
IMVQVENEYGTWGSDSKYMETMRNNVRQAGFGKVQLLRCDWSSNFFHYKLDGAVNALNFG
AGSNIDDQFKKFKEMNPDSPLMCGEYWTGWFDQWGRPHETREINSFIGSLKDMMDKRISF
SLYMAHGGTSYGQWAGANAPAYAPTTSSYDYNAPIDEAGNPTDKFYAIRDLLKNYLQEGE
SLPAIPQNPEITITIPTIKFTQTANVFENLPVAKQSENIQPMEFFDQGWGSIIYRKQLAD
CNHKQTLIIKDVHDWATVFINGKAIGKLDRRRGENTIEIPALKSAAQLDILVEGMGRVNY
GEAILDRKGITDKVILSDGNTEKELKNWTIFNLPVDYQFQTKARFTVKPATGPAWYRASF
NLTKTGYTYLDMSSWGKGMVWVNGHNLGRFWKVGPTQTLCLPGCYLKKGRNEIIVLDIDK
PKSASITGLNYPILDVIGKDDNQQQKGAKSLNLNGLNAVVTGTFPAESGWKTVNLNEMTA
GRYFCFEALNAQDPNDNSTSAAEFEIIGEDGKAISSINWKVVFVDSEETEKAANGADKLF
DIQESIIWQTKIGDKANHPHQVVIDMGKEINVKGFRILPRTDKSTKGMVKDFRFFLEKNP
FKVISQ
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaaaatcatcggtctcttaataattttactaacagccaacaactatattttc
cccttaacaccaacctcagcagatctttcaaattcattccatgccggcaaaaatgagttt
atgcttaacggaaaaccgtatattatcagagccggtgaactgcattatacccgcataccc
aaagcctattgggatcatcgcataaaaatgtgtaaagcgatggggatgaacacaatttgc
atatatttattctggaacatacatgaacagactcccggagttttcgattttaaaggacaa
aatgatgtcgctgaatttgttcgcttaatacaacaaaacggtatgtactgtattgttcgc
cccggaccgtacgtttgtgccgaatgggatatgggcgggcttccctggtggttattgaaa
aagaaagacctacaggtgcgtagccttagcgacagctattttatggaacaaacaaaaaaa
tatctgaacgaagcaggaaaacaactggctccgctacaaattcaaaatggtggaaacatc
attatggtgcaggttgagaatgaatacggaacctggggtagcgatagtaaatatatggaa
acaatgcgaaataatgtccgtcaggctggtttcggcaaagttcaactgcttcgctgcgac
tggtcatctaatttctttcactataaactggatggagctgtaaatgcattgaattttggt
gccggttccaatattgacgaccagtttaaaaaatttaaagaaatgaatcccgattcgcca
ctaatgtgcggtgaatactggacaggctggttcgatcaatggggtcgtccgcacgaaacc
cgcgagattaacagctttattggcagtctgaaagacatgatggacaaacgaatctctttc
agtctttatatggctcatggtggcacatcatacgggcaatgggctggtgctaatgctcct
gcttacgctcctactacttcgtcgtacgactacaatgcaccaattgatgaagccggcaat
ccaacagataagttctatgccatccgcgatttactaaaaaactacttgcaggaaggtgaa
tcactacctgctattcctcaaaatccggaaataaccataactattccaacaattaagttt
acgcagacggctaatgtgtttgaaaatctgcctgtagccaaacaatcggaaaatattcaa
cctatggagtttttcgaccaaggttggggttccattatttacagaaaacaactagctgac
tgcaaccacaaacaaacattgattatcaaagatgtgcatgactgggcaaccgtgtttatt
aatggaaaggccatcggaaaactggatcgacgcagaggcgaaaacacaattgaaattcct
gctctaaaatccgctgcacagttggatattctggtagaaggaatggggcgtgtaaattat
ggtgaggcgattctcgatcgtaaagggattacggataaagttatactttccgacggtaac
acagaaaaggaattaaagaactggactattttcaatctacctgtggattatcagtttcag
acaaaagcaaggtttactgtaaaacctgcaaccggtcctgcatggtacagagcttcattc
aaccttaccaaaacaggatatacttatctggacatgagctcatggggcaagggaatggtt
tgggtaaatggacataacttaggtcgtttttggaaagtaggacctacacaaacactttgc
ctgccgggttgttatttaaaaaaaggacggaatgaaattattgtgttggatattgacaaa
ccgaaatcggcaagcattaccggacttaattacccgattttggatgtaataggaaaagat
gataatcaacaacaaaaaggagccaaaagtcttaatctgaatggtctgaatgcggttgtg
actggtacgttccctgccgaaagcggatggaaaactgtcaatctgaatgagatgactgct
ggacgctatttctgtttcgaagcattgaatgctcaagatccaaacgacaacagtacatcg
gcagccgaatttgaaatcattggtgaagatggcaaagctatttcttccatcaactggaaa
gtggtatttgtggatagtgaagaaactgagaaagcagctaatggagccgacaaattattt
gacattcaggaatccattatctggcaaactaagattggagacaaagcaaatcatccgcac
caggttgtaatcgacatgggtaaagaaatcaacgtaaaaggattcagaatacttccacgc
acggacaaaagtaccaaaggaatggtaaaagactttcgttttttcctggaaaagaatccg
ttcaaagtgataagtcaataa

DBGET integrated database retrieval system