KEGG   Paludibacter propionicigenes: Palpr_0075Help
Entry
Palpr_0075        CDS       T01362                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ppn  Paludibacter propionicigenes
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppn00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
79796..82903
Genome map
AA seq 1035 aa AA seqDB search
MNKKLIIGGLLAAMFLSVSAENKLVSNDWENPAVFQINREPARATFLPFADKQSAVADIY
ENSPWFCSLNGNWKFQWSPTPDQRPKDFYKTDFNVANWKEIQVPSNWELKGYGVPIYTNS
TYPFPVNPPYIDHSDNPVGSYRRYIDLPASWNGRRVYLHFEGGTSAMYIWVNGQKVGYSE
NTKSPCEFDITKYVKSGKNLVAVEAYRWSDGSYLEDQDFWRISGIDRNVYLYSTQQIRIA
DFFAHPELDAAYKNGTLAVDVTLSNYNKSAKSAEVEASLLDATGKEIFSQNLKIKTPADG
KKEATLTSAVSSPNLWSSETPYLYTLVLSLKDENGKFIETVSSKIGFRKVELKDGQLLVN
GKRIMVHGVNMHEHNPITGHYQDLATMMKDIRMMKQHNINAVRCSHYPQNIQWVKLCDKY
GIYLVDEANIESHGMGYGKENMAFDPAWDGAHMARTVSLVERDKNSPAVILWSLGNECSN
GDVFFKTYKWIKERDKSRLVQFEQAHEKENTDVVCPMYPSIRYMKEYAARENVKRPFIMC
EYAHAMGNSSGNFKEYWDIIRGSKNMQGGFIWDWVDQGFEVTDEAGRKYWAYGGDMGSQN
YTNDENFDHNGLVFPDRIPHPGLMEVKRFYQDIYFKAEHPETGLITVANEFHYTNLQNYE
FNYEVLKNGEVIKTGSFDLDVAPESEKEVKLALPEMSAADGVEYLLNVFATTRVGTEVIP
QGHEVAREQFKLGVGNYFVKQSAAGTVKLTDEKERITMSAGGVSVSINKLSGLMDGYQFA
GKGYFNQKPTPNFWRAPTDNDFGNGMEHKCNIWRVAGSNTSIKNIAAKEENGKVTVTADL
YLRDVASDYQIVYTMSGDGELAVNVSYKAGANELPEMPRFGMIMSLDKEFENFAYYGRGP
WENYADRNNASLIGIYNSKVSDQYVPYTRPQENGYKTDLRWLTLTNNDGKGIRIEGLQPI
CASALQNWPEDFDPGLSKKYRHTNDITPNRDEVILSVDLAQRGVGGDNSWGAYPHEQYLL
KAKEYKYGFLIKPVR
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaactaattattggtggtttgttggcagctatgtttttatcggttagcgcc
gagaacaaacttgtttcaaatgactgggaaaatccggctgtttttcagattaaccgggag
ccggcacgtgccacttttctgccttttgctgataagcaatcagctgttgctgatatttat
gaaaattctccatggttctgctcgctaaatggaaactggaagtttcagtggtcacctact
cccgaccaacgcccaaaggatttttataaaacagattttaatgtggctaactggaaggaa
attcaggtgccatccaactgggaattgaaaggttacggagtacctatttatacgaatagt
acctacccgttccctgttaatccaccttatattgatcattcggataatccggtagggtct
tataggcgctatattgatttacctgcaagttggaacggtcgtcgtgtgtatcttcacttc
gaaggtggtacatcggccatgtatatttgggtaaacggacaaaaggtgggttattccgaa
aatacaaaaagtccctgcgagtttgatataaccaaatacgtaaaatccgggaaaaacctt
gtggcagtggaagcttatcgctggagtgatggctcgtacctcgaagatcaggacttttgg
cgtatttcgggtatagaccgcaacgtttatttatatagcacccagcagatacgtattgct
gatttcttcgctcatccggagttggatgctgcctataaaaacggtacgttggcagtagat
gttacattaagcaattataataaatcggctaagagtgctgaagttgaagcttctctgctt
gacgctacaggaaaagaaatatttagtcaaaatctgaaaataaaaactcctgccgatggt
aaaaaagaggctacgctgactagtgcggtttcttctcctaacttatggagtagtgaaacg
ccctatctgtatactttggtgttgtcgttgaaagatgaaaatgggaaatttatcgaaaca
gtttcaagtaagatcggtttccgcaaggttgaacttaaggatgggcagttgctggtaaat
ggaaaacgtattatggttcatggagtgaatatgcatgagcacaacccgattaccggacat
tatcaggatcttgccactatgatgaaggatattcggatgatgaaacagcataatatcaat
gctgtgcgttgtagccactatccgcaaaacatccaatgggtaaaactatgtgacaaatac
ggtatttatctggttgatgaagcgaatatcgaaagtcatggcatgggctatggtaaagaa
aatatggccttcgacccggcctgggatggagcgcacatggccagaaccgtaagtttggtg
gaacgcgataaaaattcacctgctgtaattctttggtcgctcggcaatgaatgtagtaat
ggtgatgtgttctttaaaacatataaatggattaaagaacgtgataaatcgcgcttggta
cagtttgaacaagctcatgaaaaagaaaacaccgatgtggtatgccccatgtatccaagc
atcaggtatatgaaagaatatgcagcgcgtgaaaacgtaaaacgtccgtttattatgtgc
gagtatgctcatgctatgggaaatagttccggaaactttaaggagtactgggacatcatc
cgtggaagtaaaaatatgcagggaggttttatttgggactgggtagatcagggatttgaa
gtgaccgatgaagccggacgcaaatactgggcttatggtggtgatatgggtagtcaaaac
tatacgaatgacgaaaactttgatcacaatggattagtattcccagaccgtattccgcat
ccgggcttaatggaagtgaagagattttatcaggacatctactttaaggcggagcatcct
gaaactggtctgattactgtagccaatgaatttcattataccaatcttcagaactacgaa
ttcaactatgaagtgttgaaaaacggcgaagtgatcaaaaccggttcgtttgatttggat
gtagctcccgaatcggaaaaagaagtaaaactggctttgcccgagatgtccgctgctgat
ggagtagagtatttgttgaatgtttttgcaaccacacgtgtaggtaccgaagttatcccg
caaggtcatgaggtagcgcgcgaacaatttaaactgggtgtaggtaactatttcgtaaaa
cagtctgctgcaggaacggtaaaactaaccgatgaaaaagagcgtatcaccatgtctgcc
ggaggggtaagtgtttctatcaataaactgtcgggacttatggacggatatcagtttgcc
ggcaaggggtattttaatcaaaagccaactcctaatttctggcgtgctccaaccgataat
gacttcggaaatgggatggaacacaaatgcaatatctggagggtagccggaagcaatact
tcgattaaaaatattgcagccaaagaagaaaatggcaaggttactgtcactgccgatcta
tatttacgagacgtagcatcagactatcagattgtttataccatgagtggcgatggcgag
ttggcggtaaatgtatcgtacaaagcaggagcaaacgaattacctgaaatgcctcgtttt
ggtatgattatgtcgcttgataaagagtttgaaaacttcgcgtattatggacgcggaccg
tgggagaattatgccgatcgtaacaatgcatctttgataggtatttataatagtaaggta
tccgatcagtatgttccttacactcgtccgcaagagaacggttacaaaaccgatcttcgt
tggttgacgctgacgaacaatgatggtaaaggtattcggattgaaggattacaaccaatt
tgtgccagtgcattgcaaaactggccggaagattttgatccgggactatcaaaaaaatac
cgtcatacaaacgatattactcctaatcgcgatgaagttattttatcagtagaccttgct
cagcgcggtgtaggtggcgacaacagttggggtgcttatccgcacgagcaatatctgttg
aaagcaaaagaatataagtatggatttttgataaaacccgtaaggtag

DBGET integrated database retrieval system