KEGG   Paludibacter propionicigenes: Palpr_0237Help
Entry
Palpr_0237        CDS       T01362                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppn  Paludibacter propionicigenes
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Palpr_0237
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Palpr_0237
Enzymes [BR:ppn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Palpr_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(294630..296081)
Genome map
AA seq 483 aa AA seqDB search
MKKYIITLAITLISTNLYINAKESIDSGSTKTAKQYTTSETGNQRLTYVGDLKFEARKQP
AEAEISIFVNQNKKFQTVLGIGGALTDASAETFAKMPVEKQKAFLKAYYNPIDGIGYTLA
RTNINSCDFSSDSYTYVKDGDAALKTFNVSHDLKYKIPLIKQAIAAAGGKLTLYASPWSP
PAWMKDNNDMLHGGKLLSKYNQSWANYFVRFIQEYEKNKIPVWGISVQNEPMAKQTWESC
IFTAIEEKDFVKNFLGPTLHKSGMETKKIIVWDHNRDVMVQRANDTYADKEAAKYIWGVG
FHWYEDWSGGKQQFENVQRVNEAFPDKHLIFTEGCIGNFDLSKINDWNMGEHYGESMIND
FNNGTVAWTDWNILLDEQGGPNHVKNFCFAPVHYNTKTDELIFNSEFYYIGHFSKFIKPG
ARRISASSSKSYLITTAFQNPDGKIVVVVMNKTDKSETFLVWLNGQSIKSTLPQRSISTF
FID
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatataattactttagctattacattaatatccaccaatttgtatattaat
gctaaagagagcatcgattcgggttcaacaaaaactgccaaacaatacactacttccgag
actgggaatcaacgattgacatacgttggcgacttaaagtttgaagctagaaaacaaccc
gctgaagccgagatcagcatttttgtaaaccagaataaaaagttccaaactgtattagga
atcggaggagctctgaccgatgcttctgccgaaacatttgctaaaatgcccgttgaaaaa
caaaaagcatttttgaaagcttattataatccaattgatggtattggttatacgcttgcc
agaaccaacatcaacagttgtgatttctcaagcgatagttatacctacgttaaggatgga
gatgcggctctgaaaacattcaatgttagtcatgacctgaaatataaaattccattaatc
aagcaggcaatagctgcagctggtggtaaacttacattgtatgctagtccatggagccca
ccggcttggatgaaagacaacaatgacatgctgcatggtggaaaattactgtcaaaatat
aaccagtcctgggctaattattttgttcggtttatccaggaatatgaaaaaaataagatt
ccggtttggggtatatcggtacaaaacgaaccaatggctaagcaaacctgggaatcatgt
attttcactgctattgaagaaaaagattttgtaaaaaactttctgggacctacactgcac
aaatccggcatggaaaccaagaaaatcatcgtttgggatcataatcgcgatgtgatggtg
caacgagctaatgatacctacgctgacaaagaagctgcaaagtacatttggggagttggt
tttcattggtacgaagactggagtggtggcaaacagcagtttgaaaatgtacaacgtgta
aacgaagcattccccgataaacatctcatctttaccgaaggctgtattggcaattttgat
ttatccaaaatcaatgattggaatatgggagaacattacggagagtcgatgataaatgat
ttcaataatggtacagtagcttggacggattggaatatattattggatgaacaaggtgga
cctaatcatgtaaagaacttttgctttgcaccggttcactacaatacaaaaaccgacgaa
ctgatttttaatagcgaattttattatattggtcacttttcaaaattcataaaacccgga
gccagaagaatttcggcatcttccagtaaaagttatctgattactaccgcttttcaaaac
cctgatggaaaaattgtagtagtggtaatgaataaaacagataagagcgaaacatttctg
gtgtggctgaatggccagtcaattaaatccaccttgcctcaaagatctatttctacattt
ttcattgattaa

DBGET integrated database retrieval system