KEGG   Paludibacter propionicigenes: Palpr_0237Help
Entry
Palpr_0237        CDS       T01362                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppn  Paludibacter propionicigenes
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(294630..296081)
Genome map
AA seq 483 aa AA seqDB search
MKKYIITLAITLISTNLYINAKESIDSGSTKTAKQYTTSETGNQRLTYVGDLKFEARKQP
AEAEISIFVNQNKKFQTVLGIGGALTDASAETFAKMPVEKQKAFLKAYYNPIDGIGYTLA
RTNINSCDFSSDSYTYVKDGDAALKTFNVSHDLKYKIPLIKQAIAAAGGKLTLYASPWSP
PAWMKDNNDMLHGGKLLSKYNQSWANYFVRFIQEYEKNKIPVWGISVQNEPMAKQTWESC
IFTAIEEKDFVKNFLGPTLHKSGMETKKIIVWDHNRDVMVQRANDTYADKEAAKYIWGVG
FHWYEDWSGGKQQFENVQRVNEAFPDKHLIFTEGCIGNFDLSKINDWNMGEHYGESMIND
FNNGTVAWTDWNILLDEQGGPNHVKNFCFAPVHYNTKTDELIFNSEFYYIGHFSKFIKPG
ARRISASSSKSYLITTAFQNPDGKIVVVVMNKTDKSETFLVWLNGQSIKSTLPQRSISTF
FID
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatataattactttagctattacattaatatccaccaatttgtatattaat
gctaaagagagcatcgattcgggttcaacaaaaactgccaaacaatacactacttccgag
actgggaatcaacgattgacatacgttggcgacttaaagtttgaagctagaaaacaaccc
gctgaagccgagatcagcatttttgtaaaccagaataaaaagttccaaactgtattagga
atcggaggagctctgaccgatgcttctgccgaaacatttgctaaaatgcccgttgaaaaa
caaaaagcatttttgaaagcttattataatccaattgatggtattggttatacgcttgcc
agaaccaacatcaacagttgtgatttctcaagcgatagttatacctacgttaaggatgga
gatgcggctctgaaaacattcaatgttagtcatgacctgaaatataaaattccattaatc
aagcaggcaatagctgcagctggtggtaaacttacattgtatgctagtccatggagccca
ccggcttggatgaaagacaacaatgacatgctgcatggtggaaaattactgtcaaaatat
aaccagtcctgggctaattattttgttcggtttatccaggaatatgaaaaaaataagatt
ccggtttggggtatatcggtacaaaacgaaccaatggctaagcaaacctgggaatcatgt
attttcactgctattgaagaaaaagattttgtaaaaaactttctgggacctacactgcac
aaatccggcatggaaaccaagaaaatcatcgtttgggatcataatcgcgatgtgatggtg
caacgagctaatgatacctacgctgacaaagaagctgcaaagtacatttggggagttggt
tttcattggtacgaagactggagtggtggcaaacagcagtttgaaaatgtacaacgtgta
aacgaagcattccccgataaacatctcatctttaccgaaggctgtattggcaattttgat
ttatccaaaatcaatgattggaatatgggagaacattacggagagtcgatgataaatgat
ttcaataatggtacagtagcttggacggattggaatatattattggatgaacaaggtgga
cctaatcatgtaaagaacttttgctttgcaccggttcactacaatacaaaaaccgacgaa
ctgatttttaatagcgaattttattatattggtcacttttcaaaattcataaaacccgga
gccagaagaatttcggcatcttccagtaaaagttatctgattactaccgcttttcaaaac
cctgatggaaaaattgtagtagtggtaatgaataaaacagataagagcgaaacatttctg
gtgtggctgaatggccagtcaattaaatccaccttgcctcaaagatctatttctacattt
ttcattgattaa

DBGET integrated database retrieval system