KEGG   Paludibacter propionicigenes: Palpr_0425Help
Entry
Palpr_0425        CDS       T01362                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00790  Folate biosynthesis
ppn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Palpr_0425
Enzymes [BR:ppn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Palpr_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK T4-Gluco-transf
Motif
Other DBs
NCBI-ProteinID: ADQ78585
JGI: Palpr_0425
UniProt: E4T1J1
Position
complement(510454..510822)
Genome map
AA seq 122 aa AA seqDB search
MNTAIIMLGSNVNAEVNIELAKEKLSLEFDIEKESACIISKPFGSHYVSDFCNKAVKLLS
AETKEETIYMFKSIETELGRNPQSKESGIIPIDIDLIFWNDVQVHPDYDRFDFVKKCIDE
IK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagcaataattatgttaggtagtaacgtgaatgctgaagtcaatatcgaactg
gcaaaagagaagctgtcgctggagtttgatattgaaaaagaaagtgcctgcattatatct
aaaccctttggtagtcattacgtatcggatttttgcaataaagctgtaaaacttttgtcg
gccgaaaccaaggaagaaaccatctacatgtttaaaagtatagaaactgaactgggacga
aatccgcaaagtaaagagtccggaatcataccgattgatatcgatttgatattttggaat
gatgttcaggtacatccggattatgacaggtttgactttgtgaagaaatgcattgatgaa
attaaataa

DBGET integrated database retrieval system