KEGG   Paludibacter propionicigenes: Palpr_0425Help
Entry
Palpr_0425        CDS       T01362                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppn  Paludibacter propionicigenes
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(510454..510822)
Genome map
AA seq 122 aa AA seqDB search
MNTAIIMLGSNVNAEVNIELAKEKLSLEFDIEKESACIISKPFGSHYVSDFCNKAVKLLS
AETKEETIYMFKSIETELGRNPQSKESGIIPIDIDLIFWNDVQVHPDYDRFDFVKKCIDE
IK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagcaataattatgttaggtagtaacgtgaatgctgaagtcaatatcgaactg
gcaaaagagaagctgtcgctggagtttgatattgaaaaagaaagtgcctgcattatatct
aaaccctttggtagtcattacgtatcggatttttgcaataaagctgtaaaacttttgtcg
gccgaaaccaaggaagaaaccatctacatgtttaaaagtatagaaactgaactgggacga
aatccgcaaagtaaagagtccggaatcataccgattgatatcgatttgatattttggaat
gatgttcaggtacatccggattatgacaggtttgactttgtgaagaaatgcattgatgaa
attaaataa

DBGET integrated database retrieval system