KEGG   Paludibacter propionicigenes: Palpr_0681Help
Entry
Palpr_0681        CDS       T01362                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00260  Glycine, serine and threonine metabolism
ppn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01130  Biosynthesis of antibiotics
ppn01230  Biosynthesis of amino acids
Module
ppn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Palpr_0681
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Palpr_0681
Enzymes [BR:ppn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Palpr_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ78837
JGI: Palpr_0681
UniProt: E4T293
Position
complement(826376..827740)
Genome map
AA seq 454 aa AA seqDB search
MEKTKKFLLAESELPKKWYNIVAEMPTKPMPMLHPGTKQPLKNEDLYPLFAKDLADQELN
QTDVWIDIPEEVREKLKIYRPTPLVRAYNLEKALGTPAHIYFKNESVSPVGSHKLNSALA
QAYYCKKEGTTNITTETGAGQWGTALSFAAKAFGLELAVYMVKISYEQKPYRRSLMQTWG
AQVIPSPSMSTKAGRQILTDHPNYQGSLGTAISEAIELAMSTPNCKYTLGSVLNHVSLHQ
TVIGLEAEKQMEMAGEYPDVVIGCFGGGSNFSGISFPFMRHNINEGKKTRFIAAEPTSCP
KLTRGKFEYDFGDEAGYTPLLPMFTLGHSFAPAHIHAGGLRYHGAGTIVSQLMKDGLMEA
VDIEQLDSFNAGVLFAQTEGIVPAPESAHAIAAAINEALKCKEEGTTKTILFNLSGHGLV
DMTAYDQYLAGDLMNYSLSDKDIENNVSKLEHLV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacaaagaaatttttgttggccgaaagcgagttacctaaaaaatggtacaat
atcgtagccgaaatgccaactaaaccaatgccaatgctgcatccgggaacaaaacagccg
ttgaaaaacgaagatttgtatccactttttgcgaaagatttagccgatcaggaattaaat
cagacagatgtctggattgatatacctgaggaagtgcgagaaaaattgaaaatctatcgc
cctaccccactggttcgtgcctataacctcgaaaaagcgttgggtactccggctcatatt
tattttaaaaacgaaagtgtaagcccagtaggctctcataaattgaactcggcgctggcg
caggcttattattgtaaaaaagaaggcactactaacattaccactgaaaccggagccggt
caatggggaacagcattatcgtttgctgcaaaagcctttggattggaactggccgtctac
atggtgaaaattagctacgaacaaaaaccctatcgccgttcattaatgcaaacctgggga
gctcaggttatcccttcacccagtatgtctaccaaagccggtcgccaaattttgactgat
catcctaattatcagggaagtttaggaacagcaatttctgaagcaatcgaactcgctatg
tcgacacctaattgtaaatacactttaggcagcgtattaaatcatgtttcattgcaccag
acagtgataggacttgaagcagaaaaacaaatggaaatggccggagaatatcccgatgtg
gttatcggatgttttggtggtggctctaacttctctggaatttcattcccttttatgcgt
cataatatcaacgagggaaagaaaacccgttttattgcagcagaaccaacatcatgcccg
aaactgactcgtggtaaatttgaatatgactttggtgatgaagccggttatacgcctctt
ttgccaatgtttacgttgggtcatagttttgcacctgctcacattcatgccggtggactt
cgttatcatggtgcaggaaccattgttagccagttgatgaaagatggtttgatggaagca
gttgatattgaacaactggattcttttaatgcaggtgtcctttttgctcaaactgaaggc
attgtaccggcaccagaatcagctcatgctattgcagcagccattaacgaggcattaaaa
tgcaaagaagagggaactactaaaactatcttgttcaatctgtccgggcacggtttggta
gatatgacagcttacgatcaatacctggcaggcgacctgatgaattattcgctatctgat
aaagatattgaaaacaacgttagtaagttagaacatttagtatag

DBGET integrated database retrieval system