KEGG   Paludibacter propionicigenes: Palpr_0998Help
Entry
Palpr_0998        CDS       T01362                                 

Definition
holliday junction DNA helicase subunit ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppn  Paludibacter propionicigenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Palpr_0998
Enzymes [BR:ppn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Palpr_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1201982..1202572)
Genome map
AA seq 196 aa AA seqDB search
MIDYIKGEISELTPAYVVLETAGIGYFIHITLPTFSFLGEHTSAKLYVYESIREDAHVLY
GFRLQSERQLFLLLISVSGIGANTARMIMSSYSAQEIQDMIASGNVSALNAIKGIGTKTA
QRIIVDLKDKIMKSAGGSEIISLVPNVQNEKKEEAVSALVMLGFAASASQKVVDKIVQEQ
PALKVEQLIKLALKMM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatagactatataaaaggtgaaatatcagagcttactccggcttatgttgtactggaa
acagctggaatcggctattttattcatatcactttacctactttttcgtttttgggagag
catacttcggctaagctatatgtttatgagtcaataagagaagatgcacatgttctttac
ggatttcgcctacaaagtgaacgtcagctgtttttattgctgatttcagtttcgggtatc
ggtgccaataccgcccgaatgattatgtcatcctattcggctcaggagattcaggatatg
attgcttccggcaatgtttctgctttaaatgcaataaaaggaatcggaacgaagacggcg
cagagaattattgtggatttaaaagacaaaataatgaaaagtgcgggtggaagtgagatc
atcagcttagttccgaatgtacagaatgagaaaaaagaggaggctgtttcggctttggtt
atgttaggtttcgcggcatctgcttcgcaaaaagtagttgataaaattgttcaggaacaa
ccggcgctcaaagtggaacaactcattaaactggcgttgaaaatgatgtag

DBGET integrated database retrieval system