KEGG   Paludibacter propionicigenes: Palpr_1074Help
Entry
Palpr_1074        CDS       T01362                                 

Definition
DNA replication and repair protein recr
Orthology
K06187  
recombination protein RecR
Organism
ppn  Paludibacter propionicigenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Palpr_1074
DNA repair and recombination proteins [BR:ppn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Palpr_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1300737..1301360
Genome map
AA seq 207 aa AA seqDB search
MSLQQFSSSLLENAVNEFAKLPGIGRKTALRLVLHLLKQSEYEVEVFGKAFIQLRSEIQY
CTVCHNISDTEICQICSNPSRDHETVCVVENIKDVMSIENTQQFRGLYHVLGGIISPMDG
VGPKDLEIESLIERVQTENVKEVILALSTTMEGDTTNFYIFRKLAPLNIKITTIARGIAI
GDELEYADEVTLGRSILNRVEFTNSFK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagtctacaacaattttcttcttcgctgctcgaaaatgcagtcaatgaatttgctaaa
cttcccggcatagggcgtaaaacggcattgcgactggtgttgcatttgcttaagcagtcg
gaatacgaagtggaggtgtttggcaaagcatttattcagctacggagcgaaattcagtat
tgtaccgtttgccataatatatcggacaccgaaatttgccagatttgcagtaatccgtcg
cgcgaccacgagacggtttgcgtggtggagaatatcaaagatgtgatgtccatcgaaaat
acacagcagtttcgtggattgtatcatgtgttgggcggcattatttcgcccatggatggt
gtgggacccaaagacctggaaattgagagcctgatagaacgggtgcaaaccgaaaatgta
aaagaagtgattctggcacttagcactaccatggaaggcgacaccactaacttctacatt
ttccgcaaactggctccgctgaacataaaaataaccaccattgcccgcggcatagccatt
ggcgacgaactggaatacgccgacgaagttacgctcggccgttcgatattaaacagagta
gaatttaccaattcatttaaataa

DBGET integrated database retrieval system