KEGG   Paludibacter propionicigenes: Palpr_1107Help
Entry
Palpr_1107        CDS       T01362                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00250  Alanine, aspartate and glutamate metabolism
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Palpr_1107
Enzymes [BR:ppn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Palpr_1107
Peptidases [BR:ppn01002]
 Cysteine Peptidases
  Family C44
   Palpr_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans DUF4938
Motif
Other DBs
NCBI-ProteinID: ADQ79255
JGI: Palpr_1107
UniProt: E4T3G1
Position
1350384..1352045
Genome map
AA seq 553 aa AA seqDB search
MCGIVCAFDIKQQAQALRPQVLRMSKRIRHRGPDWSGVYSDDKAILAHERLSIVDPESGK
QPLFSKDGKLVLAVNGEIYNHQEIRKQFEGKYEFLTKSDCEVILALYREKGPTFMEDLNG
IFAFALYDIEKDIFMVGRDHIGIIPLYQGWDAEGTYYVASELKALEGYCSKIEEFLPGQY
YYSPDGKPTQWYTRDWMNFDAVKDNETSIEQLHDALEAAVERQLMADVPYGVLLSGGLDS
SIISAVAMKIAAKQSASTGAAWGNQLHSFAVGLQGSPDLAAARKVAEFIGTKHHEIHFTV
QEGLDAIRDVIYHIETYDVTTIRASTPMYLLARVIKSMGVKMVLSGEGADEIFGGYLYFH
KAPSAEEFHKETVRKIDKLHLYDCLRANKSLASWGVEGRVPFLDKEFMDIAMRLNPKDKM
CGKEKMEKWILRKAFESYLPESVAWRQKEQFSDGVGYNWIDTLRAMTTELVTDEQMTKVN
ETYPINPPMNKEEYYYRTIFTDFFPSDAASKCVPSVPSVACSTPIALEWDEAFKNLNDPS
GRSVKTVHEDGYK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtatgtgcatttgatataaaacagcaggctcaggctctgcgaccacaa
gttttgagaatgtcgaaacgtatacggcatcgtgggccggactggtcgggagtttattcc
gatgataaagctattttagcacacgaacgactttcaattgtagatccggaatcaggaaaa
caaccgctattcagtaaagatggtaagttggtactggctgtaaacggtgaaatatacaat
catcaggaaatacgcaaacaatttgaaggcaaatatgaatttctgaccaaatccgactgt
gaagtgattttggcattgtaccgcgaaaaaggtcccacctttatggaagacctgaacggt
attttcgctttcgcgctttacgatattgaaaaagatatcttcatggtaggacgcgatcac
atcggtatcattccgttgtatcagggttgggatgccgaaggaacgtactacgtagcttcg
gagctaaaagcactagaaggctattgctctaaaatagaagaattccttcccggtcaatac
tattacagtccggatggaaaaccgacacaatggtacacccgcgactggatgaactttgat
gcggtaaaagataacgaaacaagtatagaacaactgcacgatgcattggaagctgctgta
gaacgccagttgatggccgacgtaccttacggtgtgttgctttcgggaggattggattcg
tccatcatttcggctgtagccatgaaaattgccgctaaacaatcggcaagtaccggcgct
gcatggggaaatcaactacactcttttgctgtaggattgcagggatcgcctgacctggct
gctgcccgcaaagtagctgaatttatcggaacaaaacaccacgaaattcatttcaccgta
caagaaggactcgacgctatccgcgacgtaatataccatatcgaaacatacgatgtaaca
accatccgcgcaagtacccctatgtacctgttggctcgcgttatcaaatcgatgggcgta
aaaatggtactttcgggcgaaggtgctgatgagatattcggcggttacctgtatttccac
aaggcaccaagtgctgaagaattccacaaagaaactgtacgcaaaatagacaaacttcac
ctgtacgactgcttacgcgccaacaaatcattggcatcgtggggtgttgagggtcgtgtg
ccgtttctggacaaagaatttatggatattgccatgcgcctgaatccaaaagacaagatg
tgcggcaaagaaaaaatggagaaatggattttgcgcaaagcatttgaaagctatctgccc
gaaagtgttgcatggcgtcagaaagaacaattctcggatggtgtgggttacaactggatt
gacacgctgcgtgccatgactaccgaactggttaccgacgagcaaatgactaaggtaaac
gaaacctaccctatcaatccgccaatgaataaggaagaatactactatcgtactatcttc
accgatttcttcccatcggatgcagcgtcgaaatgtgtgccttcggtaccttcggtagct
tgctctactcctatcgcgctcgaatgggatgaagcgttcaaaaacctgaatgatccttcg
ggacgttcggtaaaaacggttcacgaagacggatataaataa

DBGET integrated database retrieval system