KEGG   Paludibacter propionicigenes: Palpr_1264Help
Entry
Palpr_1264        CDS       T01362                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00010  Glycolysis / Gluconeogenesis
ppn00051  Fructose and mannose metabolism
ppn00562  Inositol phosphate metabolism
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01120  Microbial metabolism in diverse environments
ppn01130  Biosynthesis of antibiotics
ppn01200  Carbon metabolism
ppn01230  Biosynthesis of amino acids
Module
ppn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Palpr_1264
   00051 Fructose and mannose metabolism
    Palpr_1264
   00562 Inositol phosphate metabolism
    Palpr_1264
Enzymes [BR:ppn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Palpr_1264
Exosome [BR:ppn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Palpr_1264
  Exosomal proteins of bladder cancer cells
   Palpr_1264
  Exosomal proteins of melanoma cells
   Palpr_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADQ79411
JGI: Palpr_1264
UniProt: E4T3W7
Position
1522577..1523332
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGLALATELNKALAGSTPNCDVVIGTPAIHLASVAAAIDTTKI
GVAAQNCANKESGAYTGEISAAMVKSTGANYVILGHSERREYYGETSAILNDKVALALAN
GLTPIYCCGEALEVRNANGQNAYVKNQLEETIFNLSADDFKKIVIAYEPIWAIGTGVTAS
TEQAQDMLAFIRTIIAEKYGKEIAENTSILYGGSCNAKNAGELFAQPDIDGGLIGGASLK
VEDFKAIIDAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgttgcaggaaactggaaaatgaacaaaaccctacaagaagggtta
gcattggcaactgaattgaataaagcattggccggatcaactccaaattgcgatgtagta
atcggaactcctgctatccatttagcaagcgtagctgctgctatcgacacaacaaaaatt
ggcgtagctgctcaaaactgtgctaacaaagaatcaggtgcttataccggagagatcagt
gctgctatggtaaaatctaccggagctaattatgtaatccttggtcactctgagcgtcgc
gagtattatggtgaaaccagcgctattcttaacgacaaagtagctttggcattggctaac
ggtctaactcccatttattgctgcggtgaagcactggaagtacgcaacgcaaacggacaa
aacgcttatgtaaaaaaccagttggaagaaactatcttcaacctgagcgccgatgatttc
aaaaaaatcgttatcgcttacgaaccaatctgggctatcggaaccggtgtaactgcttct
actgagcaagctcaggatatgttggcatttatccgcacaatcattgctgaaaaatatggc
aaagaaatagcagaaaatacatcaattctttacggtggaagctgtaacgctaaaaatgca
ggcgaattgtttgctcagcctgatatcgacggtggattgattggcggtgcttctctgaaa
gttgaagacttcaaagctattatcgacgcattttga

DBGET integrated database retrieval system