KEGG   Paludibacter propionicigenes: Palpr_1264Help
Entry
Palpr_1264        CDS       T01362                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppn  Paludibacter propionicigenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Palpr_1264
   01230 Biosynthesis of amino acids
    Palpr_1264
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Palpr_1264
   00051 Fructose and mannose metabolism
    Palpr_1264
   00562 Inositol phosphate metabolism
    Palpr_1264
Enzymes [BR:ppn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Palpr_1264
Exosome [BR:ppn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Palpr_1264
  Exosomal proteins of bladder cancer cells
   Palpr_1264
  Exosomal proteins of melanoma cells
   Palpr_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1522577..1523332
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGLALATELNKALAGSTPNCDVVIGTPAIHLASVAAAIDTTKI
GVAAQNCANKESGAYTGEISAAMVKSTGANYVILGHSERREYYGETSAILNDKVALALAN
GLTPIYCCGEALEVRNANGQNAYVKNQLEETIFNLSADDFKKIVIAYEPIWAIGTGVTAS
TEQAQDMLAFIRTIIAEKYGKEIAENTSILYGGSCNAKNAGELFAQPDIDGGLIGGASLK
VEDFKAIIDAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgttgcaggaaactggaaaatgaacaaaaccctacaagaagggtta
gcattggcaactgaattgaataaagcattggccggatcaactccaaattgcgatgtagta
atcggaactcctgctatccatttagcaagcgtagctgctgctatcgacacaacaaaaatt
ggcgtagctgctcaaaactgtgctaacaaagaatcaggtgcttataccggagagatcagt
gctgctatggtaaaatctaccggagctaattatgtaatccttggtcactctgagcgtcgc
gagtattatggtgaaaccagcgctattcttaacgacaaagtagctttggcattggctaac
ggtctaactcccatttattgctgcggtgaagcactggaagtacgcaacgcaaacggacaa
aacgcttatgtaaaaaaccagttggaagaaactatcttcaacctgagcgccgatgatttc
aaaaaaatcgttatcgcttacgaaccaatctgggctatcggaaccggtgtaactgcttct
actgagcaagctcaggatatgttggcatttatccgcacaatcattgctgaaaaatatggc
aaagaaatagcagaaaatacatcaattctttacggtggaagctgtaacgctaaaaatgca
ggcgaattgtttgctcagcctgatatcgacggtggattgattggcggtgcttctctgaaa
gttgaagacttcaaagctattatcgacgcattttga

DBGET integrated database retrieval system