KEGG   Paludibacter propionicigenes: Palpr_1284Help
Entry
Palpr_1284        CDS       T01362                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppn  Paludibacter propionicigenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Palpr_1284
Enzymes [BR:ppn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Palpr_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1547654..1550338
Genome map
AA seq 894 aa AA seqDB search
MKIQFNIHYKTQWGQSMYLLIYKSAEQPENSSSEGIIMQCNEKSEWNTEISLDSAGSICY
QYAILNPDKSFDYEYGGIRKVELTPSKETVLIYDNWRASYGDSPFITAAFSDCFFNRTKS
NDETHTTEGSLILRLNCPQMEPDRHFAIVGNQEVLGNWDVTHKVRLNESQFPIWSISLDV
EKISFPLEYKYLIVDTKTDEVLAWGGGPNRILQQAEKQSLTVVNDEHFIRTIPSWRGAGV
AIPVFSLRSEKSFGIGEFNDLKKMVDWAKKTGQRIIQTLPINDTILYHTNYDSYPYNAVS
VYALHPIYLNLDSLGKLKTKKQKDYFLAKKQELNAQTFSDYQHVMNTKWEFFKIIYPQES
PAVFASEDYKTFFEANKEWLVPYAAFSYLRDLYGTPEFGKWPDHNIYNSTEIETLSAPDQ
AHYNDIAIFYFLQYHLHKQLVEVHDYARANGIAIKGDIPIGVSPRSVDAWVDPYLFDTDL
QAGAPPDDFSATGQNWGFPTYNWELMEENGYEWWKKRFQKLAEYFDAYRIDHILGFFRIW
GIPVDAVWGLTGSFQPALPFSYQELESKGVWVDEDRFLKPYLKEHVLYATFGKYTDDVIR
EYLLPDGWQNYKFKPEFDTQKKIEKHFATLGYNFGNKEVLIRDGLYMLHCEVLFVRDSHQ
PNKIHPRISMHNSATFRDLPENTRRLLDKIYVDYFYHRHTEFWKQQALKKLPALISATNM
LVCGEDLGMVPDSVPDVMNNLEILSLEIQRMPKKPNTEFAMPSDAPYRSVCTTSTHDMNP
IRAWWEEDPVLTQRFYNRALGMQGPAPATCENWIAERIIEQHLESNAMLIILPWQDWMAL
DSTLCLEHPFAERINVPSNPRNFWCYRMHMTLEQLLKESKFNSKIKEMIEKSGR
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacaattcaatatacattataaaacccaatggggacaatctatgtatctgttg
atttacaaatcagcggaacaacctgagaacagttcttcggaaggtattattatgcaatgc
aacgagaaatcggaatggaacactgaaatatcattggattctgctggctcgatttgctac
caatacgccatacttaatccagacaaatcttttgattacgaatatggtggcatccgaaaa
gttgaactgactccgtcaaaagaaactgttctgatctacgacaactggcgcgcatcttac
ggcgacagtccatttataacagcagcattttcagattgtttcttcaatcgcacaaaatca
aatgacgaaactcacactactgaaggcagcctgattcttcgcctgaattgcccacaaatg
gagcctgaccgccactttgccatagttggcaatcaggaagtattgggaaattgggatgtt
actcataaggtcagacttaacgaatcgcaatttcccatttggagcatcagccttgatgtc
gagaaaatctcttttccccttgaatataagtatctgattgtcgacacaaaaaccgatgaa
gtactggcctggggtggtggcccaaacagaattcttcagcaggcagaaaaacaatcactt
accgtggttaatgacgaacattttatcagaactatcccctcgtggagaggtgcaggtgtg
gcaattccggtgttctcgcttcgtagcgaaaaaagttttggaatcggagagttcaatgat
ttaaagaaaatggtggattgggcaaaaaaaacaggtcaacgcattatacaaactctgccc
atcaacgacaccattctttaccacaccaattacgattcatacccttacaatgcggtttct
gtttatgctttgcatcctatctatttgaatttagacagtttaggcaaactcaaaacaaaa
aaacagaaggattattttctcgctaaaaagcaagagctcaacgctcagactttttctgat
taccagcatgtaatgaataccaaatgggagttttttaaaattatctacccccaggaaagc
cctgctgtttttgcatcagaagactataaaacattttttgaagccaataaagaatggctg
gttccctatgcagcattctcttacctgcgggatttgtacggcacacccgaatttggtaaa
tggcctgaccacaatatctacaattcaacagaaatagaaaccttatcagctcctgatcag
gctcattataatgacattgctatcttttacttcctgcaatatcatttgcataaacaattg
gttgaagtacacgattatgcacgagccaacggaattgcaataaaaggcgatattcctatc
ggcgtaagcccccgaagcgttgacgcctgggtagatccttatctttttgacactgatttg
caagccggagcaccccccgatgatttttcggcaacaggtcaaaactggggttttcctacg
tacaattgggaattaatggaagaaaacggatacgagtggtggaaaaaacgattccaaaag
ctcgcagaatattttgacgcataccgcattgatcacatccttggcttcttcagaatttgg
ggaattccggtggatgctgtatggggattaaccggcagtttccaacctgctttgccattt
tcctatcaggaacttgaatcgaaaggagtttgggttgatgaggatagattcctgaaacct
tatttaaaagagcatgttctgtatgcaacttttggaaagtacaccgacgatgttatacgg
gaatatcttttacctgatggttggcaaaattacaagttcaaacccgagtttgatacgcag
aaaaagattgagaaacattttgcaactctcggatacaacttcggaaataaggaagtgctc
attcgggatggtttgtatatgcttcactgcgaagttcttttcgttcgcgactcacatcaa
ccgaacaaaatacatccgcgaatttcgatgcataattcggctacgttccgtgatttgccc
gaaaacactcgccgattacttgataaaatatatgtggactacttctatcatcgccatact
gaattttggaaacagcaggctttgaagaaacttccggctttaatatcagcaacgaatatg
ctggtttgtggcgaagatttgggcatggtgcccgattcggtgccggacgttatgaataat
cttgaaattctcagtctggaaatacaacgaatgcctaaaaagccaaacaccgaatttgca
atgccttcggatgctccatacagatcagtctgtacaacttccactcacgacatgaatccg
atacgtgcatggtgggaagaagacccggttttaacccaacgtttttacaatagagcgctg
ggaatgcaaggtccggcacctgctacctgcgaaaactggattgcagaacgcattatcgag
caacatctggaatcaaatgccatgttgataattttaccgtggcaggattggatggcgctg
gactctactctttgtctagaacatccgtttgcagaacgtatcaacgtgccaagcaatcca
agaaatttctggtgctacagaatgcacatgacgctggaacagctattgaaggagagcaaa
tttaatagcaaaataaaagaaatgattgaaaaatcaggtcggtag

DBGET integrated database retrieval system