KEGG   Paludibacter propionicigenes: Palpr_1414Help
Entry
Palpr_1414        CDS       T01362                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppn  Paludibacter propionicigenes
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Palpr_1414
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Palpr_1414
   00640 Propanoate metabolism
    Palpr_1414
   00660 C5-Branched dibasic acid metabolism
    Palpr_1414
Enzymes [BR:ppn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Palpr_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1682887..1684041
Genome map
AA seq 384 aa AA seqDB search
MKIHEYQARQLFRKYGIPVPEDVLCYTVSEVEKAAKDLNRMVVVKAQVLVGGRGKAGGVK
LARNVEDAVSAAKQILGMDIKGYKVEKVLVADAVDISKEFYVGLINDRNSKTVTLMASSE
GGVEIEEVAKENPEKIIKFHINPLTGLLDYQARDIALQLFGEIKTAQKAASIFKKLYKLY
VETDATIAEINPLVLTPDNEVLAIDGKMNFDDNALFRQPEILAMREPDEDELVEIDAHSK
GLSYIRLDGNIGCMVNGAGLAMATMDMIKLYGGEPANFLDIGGSSSPQKVIDAMNILLND
KHVKAVMINIFGGITRCDDVAKGLIKAMEVISTDIPIVVRLSGTNAAEGLELLKQTNLPT
VSSMSEAAQLAIELSNNLIFTPHK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgaatatcaagccagacaattgttcaggaaatacggaataccagttccg
gaagatgtattatgttatactgtaagcgaagtagaaaaagccgctaaggatttaaaccga
atggtagtagttaaagctcaggttttagtaggtggaagaggtaaagcaggtggagttaag
cttgccagaaatgtagaggatgctgtttctgcagcaaaacagattttgggaatggatata
aagggatataaagttgaaaaggttttggtagccgatgcagtagacatctctaaagaattt
tatgtcggactaattaacgacaggaatagcaagacggtaactttaatggcaagctcagaa
ggaggagttgaaattgaagaagttgcaaaagaaaaccctgagaagattattaaatttcat
attaatcctcttactggattacttgactaccaggcaagggatatagcgttacagcttttt
ggagaaatcaaaactgcccaaaaggctgcttctattttcaagaagctatataaattgtac
gtagaaacagatgcaactattgctgaaataaatccattggtgcttactccagacaacgag
gtacttgccatagatggaaaaatgaattttgatgataatgcacttttccgtcagcctgag
attttggcaatgcgagaacccgatgaagatgaattagtggaaattgatgctcatagcaaa
ggattatcttatatccgcttggatggaaatataggttgcatggtcaatggagctggattg
gcaatggctactatggatatgattaaattgtatggtggagaaccagctaattttctggat
attggcggtagttcaagtccgcaaaaagtgattgacgccatgaacattctgctaaacgac
aaacatgtaaaagccgtaatgatcaatatttttggtggaataacacgatgcgacgatgta
gcgaaagggcttataaaggctatggaggtgatatcaacagatataccgattgtagtacga
ctctcaggaacgaatgcagcagaaggacttgagttactaaaacaaaccaatcttcctaca
gtaagttcaatgagcgaagctgctcagctagcaatagaacttagcaacaaccttattttt
acaccacataaataa

DBGET integrated database retrieval system