KEGG   Paludibacter propionicigenes: Palpr_1479Help
Entry
Palpr_1479        CDS       T01362                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00500  Starch and sucrose metabolism
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Palpr_1479
Enzymes [BR:ppn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Palpr_1479
Exosome [BR:ppn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Palpr_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADQ79625
JGI: Palpr_1479
UniProt: E4T4I1
Position
complement(1754255..1756261)
Genome map
AA seq 668 aa AA seqDB search
MEELAILKSDSLLAPYANAINGRYEYFESIEKKLVPEGQTLSNFATGYLYFGLHRLSDGW
VFREWAPNASAIFLIGDFNNWQRHPDYQLKRIQNGNWEIRLPDYAIAHTQLYKLLVEWEG
GSGERIPAWARRVVQDDTTKIFSAQVWSPFQPYVFKNTKFKPTTDPLLIYECHIGMSSSQ
EKVSTYEEFRTTVLPRIHRDGYNCIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPDELK
HLIDDAHGLGISVIMDIVHSHAVRNEVEGLGRFDGTPYQYFHGGSRREHPAWDSLCFDYA
KPSVLHFLLSNCKFWLEEYKFDGFRFDGVTSMLYRSHGLGEDFSGYESYYNMNQDGDAIC
YLTLANKLIHQVNPYAITVAEEVSGMPGLATRVEDGGIGFDYRMAMGIPDFWIKQIKEIK
DEDWKVGNILWELTNRRVEEKTINYAESHDQALVGDKTIIFRLIDSEMYWHMQRGDSTLV
VDRGVALHKMIRLITATTINGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWELVDN
EKYLYNALGEFDRSMIELINSVPEFNKTAIQQLWDKEGDQVLAFQREDMVFVFNFNGLKS
FTDYGILADQGSYEIVLNTDNSVFGGFDLIDESVVHVTTPYPRDPSGREWLKLYIPARTA
FVLKKKAD
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacttgcaatattaaaatccgactcactattggctccttatgccaatgccata
aacgggcgatatgagtatttcgaaagcattgaaaaaaaactggtgcccgaagggcaaacc
ctgtctaattttgctaccggttatttatatttcgggctgcaccggctttctgatggctgg
gtgtttcgggagtgggcacccaatgcttcggcaatattcctgataggcgattttaataac
tggcaacgacatcccgactatcagttaaagagaatccaaaacggcaactgggaaattcgc
ttgcccgattatgccattgcacatactcagttatacaaactgctcgtggagtgggagggc
ggaagcggcgaacgtattccggcatgggcgcgcagagtagtgcaagacgatactactaaa
attttcagtgcgcaggtttggagtccgtttcagccttacgtattcaaaaataccaaattc
aaaccgactaccgacccgttgttgatctatgaatgccatattggcatgtcgagttcgcag
gagaaggtttctacttacgaagaatttcgcaccacagttttgccccgcattcatcgcgac
gggtacaattgtattcagataatggccattcaggagcatccgtattacgggtcttttggc
taccatgtgtccagtttttttgctgcttcgtcgcgtttcgggacacccgatgagctgaaa
catttaattgatgatgcgcacggactgggcatttcggttattatggatattgtgcattcg
cacgccgtaaggaatgaagttgagggactgggtcgtttcgacggaactccttatcagtat
tttcatggcggttcgcgccgcgagcatccggcgtgggattcgctctgcttcgattatgcc
aagccgtcggtacttcactttttattatcaaactgtaagttctggctggaggaatataaa
tttgacggtttccgctttgatggggttacttctatgctttatcgtagtcacggactgggc
gaggatttttcagggtacgaatcatactataacatgaaccaggatggtgatgccatttgt
taccttacgctggctaacaaattgattcatcaggtaaatccttatgctataacggtggct
gaagaggtcagcggtatgcctggtttggctaccagggtagaagatggtggtattggtttc
gattatcgaatggccatgggaatcccggatttctggattaaacagataaaggagataaaa
gatgaagactggaaagtgggcaatatcttgtgggaattgaccaaccgtagagttgaagaa
aaaaccattaattatgccgaaagccacgatcaggctttggtaggcgataaaactattatt
ttccgtctgattgattcggaaatgtactggcacatgcagcgcggcgacagtacgctggtg
gtagacagaggggtagctctgcataaaatgatcaggcttattaccgccaccaccatcaac
ggaggttacctgaactttatgggaaatgaattcggacatcccgaatggatagattttccg
cgcgaaggtaacggctggtcatacaaatatgcccgtcgccagtgggaactggtagataac
gaaaaatatctttataatgcgttgggcgagtttgaccgctccatgattgaactgataaac
tcggttccggagtttaataaaaccgccattcagcaactttgggataaagaaggagatcag
gtgctggcttttcagcgtgaagatatggtatttgtgtttaatttcaatggattgaaatcg
tttacagattatggaatcctggccgatcagggtagttatgagatagtactcaataccgac
aattctgtttttggtggatttgatttaatcgatgaatctgtagtgcatgttactacgcct
tacccacgtgatccttcaggacgagaatggttgaagctatatattccagcacgtacagca
tttgtgctcaagaaaaaggctgattga

DBGET integrated database retrieval system