KEGG   Paludibacter propionicigenes: Palpr_1503Help
Entry
Palpr_1503        CDS       T01362                                 

Definition
UDP-N-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ppn  Paludibacter propionicigenes
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Palpr_1503
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Palpr_1503
Enzymes [BR:ppn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Palpr_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1787257..1788702)
Genome map
AA seq 481 aa AA seqDB search
MMLDDILQNVILLKTIGNIDINVSGIQFDSRKVEAENVFVATRGTASDGHQYIATAIENG
AVAIVCEELPSEINPNITYVKVEDSSDALGKMASAWYDFPSTKMTLVGVTGTNGKTTIAT
LLYQLFRELGHKSGLLSTVCNYVNDLAVEATHTTPDALALNALLAQMVDAGCEYAFMEVS
SHSIDQHRISGLEFDGAIFTNITRDHIDYHLTFENYLKAKKQFFDNLSTDAFALTNADDK
NGLVMLQNSKAKKYTYSLRGMADFKTRILEHGFEGMLLDMNDKEVNVSFIGKFNASNLSA
VFGAAVLLGQDELEVLRIISSLHSVSGRFETLHSPAGYTAIVDYAHTPDALVNVIGTINQ
ILQGNGRLITVVGCGGNRDKGKRPMMAREAVNGSWKAILTSDNPRFEEPQEILNDMLAGL
DVVEKAKSLTIVDRREAIKTACALAQAGDVVLVAGKGHEDYQIIQGVKHHFDDREEVRKC
F
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggacgatatattgcaaaatgtaattttgctgaaaactataggaaatattgat
attaatgtttcgggaattcaatttgattcgcgaaaagtggaagcggaaaatgtttttgtt
gccacgcggggaactgcatcggatggtcatcagtacattgccactgccattgagaacgga
gcggtagcgattgtttgtgaagaattgccttcagagataaatccaaatataacctatgta
aaagtggaggacagttccgatgcgttaggaaaaatggcttcagcgtggtacgatttccca
tcaacaaaaatgactttggtgggtgtgaccggtacaaacgggaaaaccactattgctacc
ctattgtatcagctgtttcgtgaactgggacataaatcaggtttattatccaccgtttgc
aattatgtaaacgacttggctgtagaagcaactcacaccacaccggatgcattggctttg
aatgctttgcttgctcagatggttgatgccggatgtgaatatgcatttatggaggtcagt
tcgcattcaatagaccaacaccgtatttcgggtttggaatttgatggtgctatttttacg
aacattacccgtgatcatattgactatcaccttactttcgagaattatctgaaagctaaa
aagcaatttttcgataatttgtcgactgatgcatttgctctgactaacgcagatgacaag
aacggtttggtaatgcttcagaactcgaaagcgaagaaatatacttattcgttgcgcgga
atggccgattttaaaacccgtattttggaacatggttttgaaggcatgttgctggatatg
aatgataaagaagtgaatgtgtcatttatcggaaaatttaatgccagtaatctgtcggct
gtgtttggtgctgctgtgttgctcggacaagatgaactggaggtgttgcgcataatcagt
tcattgcattcggtatcaggccgattcgaaaccttacattctcctgcaggctacacagct
attgtggattatgctcatactcccgatgcgttggtgaacgtcatcggcactataaatcaa
attcttcaaggcaatggtagattgataaccgttgtgggatgtggaggaaatcgtgataaa
ggaaaacgtccgatgatggctcgcgaggcagtaaatggtagttggaaggcgatattaacc
tctgacaatcctcgttttgaagaacctcaggaaatattaaatgatatgttggccggactc
gatgtggttgaaaaagcgaaaagcctgactattgttgataggagagaggcaatcaaaacg
gcatgtgcgctggctcaggccggcgatgtagtactggttgcaggcaaaggacacgaagat
tatcaaataatacaaggtgtaaaacaccatttcgacgacagagaagaagttcgaaaatgc
ttttaa

DBGET integrated database retrieval system