KEGG   Paludibacter propionicigenes: Palpr_1630Help
Entry
Palpr_1630        CDS       T01362                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00052  Galactose metabolism
ppn00561  Glycerolipid metabolism
ppn00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Palpr_1630
  Lipid metabolism
   00561 Glycerolipid metabolism
    Palpr_1630
   00600 Sphingolipid metabolism
    Palpr_1630
Enzymes [BR:ppn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Palpr_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NPCBM Melibiase_2 He_PIG_assoc He_PIG Melibiase
Motif
Other DBs
NCBI-ProteinID: ADQ79771
JGI: Palpr_1630
UniProt: E4T4X7
Position
complement(1939873..1941915)
Genome map
AA seq 680 aa AA seqDB search
MKTTSNIRLAAIAGFIIISSLLGFGQVSAQTVWLDQLDLSTATQGYGVPMKNKSLDGHPL
TIAGKTFERGFGSHSESSLTILLEGKATLFTAQVGIDDEVKGQRPAAEFVVYGDNKKLWA
SGVMHLGDAAIPCSVKLDGVKKLELVVTDGGNGNYYDHVDWVDAKFETTGVSTFKTFSPV
ATEPYILTPAPKSTPKITGAKVFGVRPGSPFQYLVTATGDRPMTFSATGLPKGLKINTQT
GLITGKLTKVGTYLVSLEAKNAKGKAVRKFKIECGDKIALTPPMGWNSWNCFAQEVSADK
VKRAANAMVKSGLINHGWTYINIDDFWENNRDSKDQSIRGKFRDEAGNIVPNSRFVDMKG
LADYVHGLGLKIGLYSSPGPWTCGGCAGSYGYEKLDAESYAKWGFDYLKYDWCSYGNVIN
GLPNNDPLKVSSLSYNGGSVLSTAMKPFQLMGDLLKQQPRDIVFSVCQYGMSDVWKWGGS
VGGNLWRTTNDITDTWASVKSIILDQDKSAAYAKPGNWNDPDMLVVGHVGWGNPHPSKLR
PDEQYLHISLWSLFAAPLLIGCDMEKLDDFTLNLLTNDEVIEINQDPLGKQATCIQTIGE
LRIYVKELEDGSRAVGFCNLGADIIDISYKDFDKIGLNGKFNVRDVWRQKNISTIETKTS
QLALKVPVHGVLLYKFTATK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacaagtaacattagattagctgctattgcaggttttataatcatttccagt
ctgctgggttttgggcaggtttctgctcaaactgtatggcttgatcaactcgatcttagc
acagcaactcagggttatggagttccaatgaaaaacaaatctctcgatggtcacccacta
actatagcaggtaaaactttcgagcgtggttttggaagccattctgaaagctcgttgact
attttgctcgaagggaaagctactttatttacagctcaggttggtatagacgatgaggta
aaagggcagaggcctgcagccgaatttgttgtttatggtgacaataaaaaattatgggcg
agtggagtaatgcatctaggcgatgctgccatcccttgttctgtgaagcttgatggagtt
aaaaaactagagttggtggtaaccgatggaggaaacggcaattactacgatcacgttgat
tgggtagatgcaaagtttgaaaccaccggagtaagtacttttaaaactttcagtcctgta
gcgaccgagccttacattcttactcctgctcctaaatcaaccccaaagattaccggagct
aaagtttttggtgtgcgtcctggttcaccgtttcaatatcttgtaacagctactggcgat
cgtccgatgactttctcagctacaggtttgccgaagggcttgaagataaacacccaaact
ggtcttattactggtaaacttacaaaggtgggtacttatcttgtttcgctggaagctaaa
aatgcgaaaggcaaggcagtaagaaaatttaaaatagaatgtggcgacaaaattgcactt
actccaccgatgggttggaatagctggaactgttttgcgcaggaggtctcagccgacaaa
gtgaaacgagcagccaacgccatggtgaaaagcggacttatcaaccacggttggacttat
atcaatattgatgacttctgggaaaacaaccgtgattccaaagatcaatccatacgtggt
aagttccgcgatgaggcaggtaacattgttccaaactcacgttttgtagatatgaaaggt
ctggctgattatgtgcatggacttggtctgaaaattggattgtattcaagtcccggccca
tggacgtgtggtggatgtgccggaagttatggttatgaaaaacttgatgccgaaagctat
gccaaatggggcttcgattaccttaaatacgactggtgcagttatggtaatgtgattaac
ggtttgccgaacaacgatccattgaaagtatcgtctttgtcgtacaatggtggtagtgta
ttgagtactgccatgaaaccatttcagctaatgggtgatttattgaagcaacaaccccgt
gatattgtatttagcgtgtgtcagtacggtatgtctgacgtttggaaatggggtggttcg
gttggtggcaatttatggcgcaccaccaatgacattaccgatacctgggctagtgtaaaa
agcattatactcgatcaggataaatcggctgcttatgcaaagccgggcaattggaatgat
cctgatatgcttgtagttggtcatgtaggttggggaaatccgcatccaagcaaacttaga
cccgatgaacaatatcttcatatcagtttatggagcttatttgctgcgccgcttcttatt
ggttgcgatatggaaaaactggatgactttaccttgaatttgctaacaaatgatgaagtc
attgaaatcaatcaggatccgcttggtaaacaagctacatgcatacaaaccataggtgag
cttcgtatttacgtgaaagagcttgaagatggcagtcgtgccgttggattctgtaattta
ggtgctgatattatagatatttcatacaaggatttcgataaaattggtcttaacggaaaa
tttaatgtacgtgatgtatggagacaaaaaaatattagcacaatcgaaactaaaacaagt
cagctagcactcaaagttcctgttcacggagtgttactttataaatttacagctacaaaa
taa

DBGET integrated database retrieval system