KEGG   Paludibacter propionicigenes: Palpr_1811Help
Entry
Palpr_1811        CDS       T01362                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppn  Paludibacter propionicigenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2173341..2174336)
Genome map
AA seq 331 aa AA seqDB search
MKLSTKIALIFIVVMPITLCNATSKTTKKIPPANSPVALNGKLQVIGTQLSNSKGNSLAL
HGASLGWHNLWPRFYNAGAVKWLVSDWKCNVIRASMGVGLDDSYLENPDYALKCMTNVID
AAIKNGVYVLIDFHSHKLHTAEAKKFFTGMAAKYKNSPNVIYEIWNEPDYYSWKVVKQYS
EEVISTIRAIDPTNIILVGSPHWDQDIDSVAGDPIVGQKNIMYTMHFYAGTHKKWLRDKT
DAVIAKGIPIFVSECAGMDATGDGPIDQAEWKLYIDWMDRAKLSWCVWSVSDKNETCSML
LPRASSTGNWDDGLLKSWGKISRSSIREMNK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctcaactaaaattgctttgatttttattgttgtgatgcctataacgctatgt
aatgctacatcgaaaacaacaaaaaagattcctcctgcaaactctcccgttgccttaaat
ggcaaacttcaggttattggtactcagttatcaaactcaaaaggaaattctctggcactt
catggtgctagccttggatggcataacctttggccacgtttttataatgcgggagctgta
aagtggcttgtttccgactggaaatgtaatgttatccgtgcttcaatgggcgtgggtttg
gacgacagctatctggaaaatcctgattatgcactcaaatgcatgacaaatgtaatcgat
gctgccatcaagaacggagtttatgtattgattgattttcatagccataaactacatacg
gctgaagcaaaaaaattcttcacaggtatggctgccaagtataaaaatagcccgaacgtc
atctacgaaatatggaatgagcccgattattattcatggaaagtagtgaaacagtattca
gaagaagttatttcaacgattcgtgccattgatcctactaatataattcttgtgggctct
cctcattgggatcaggatattgattctgttgcaggtgacccaatcgttggacaaaagaat
atcatgtatactatgcatttttatgcagggactcataagaaatggttgcgtgacaagact
gatgccgtcatagcaaaaggaatcccgatttttgtttctgaatgtgccggaatggatgcg
acaggagatggaccgattgaccaagcagaatggaaactgtatatcgattggatggataga
gctaaattaagttggtgtgtatggtcagtttcagataagaacgaaacttgttcgatgtta
cttccacgcgcttcttctaccggaaactgggacgatggactgttgaaaagctggggtaaa
atcagtcgttcttctattcgcgaaatgaataaatag

DBGET integrated database retrieval system