KEGG   Paludibacter propionicigenes: Palpr_2078Help
Entry
Palpr_2078        CDS       T01362                                 

Definition
nad-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ppn  Paludibacter propionicigenes
Brite
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Palpr_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2523133..2524110)
Genome map
AA seq 325 aa AA seqDB search
MKVLVTGANGLLGHHVVFELVKRQLDVRVIVRSTENIYFDVAKTDVYVGNFTDYESLKQA
AAGCDAIIHIAAVTATDLLHYEDYSKINVDGSRLLLKVANELNINKIVYVSSANTIGFGT
EQEPADECFNIEFPFTESYYAQSKVASEKLFIEASKKSNMHVVIINPTFMIGSYDTKPSS
GKLMLMGYKKRLMLIPKGGKNFVSAHDVAVSVCNALVEGQTGERYLASGINLSFKEFYSL
QIQIENYKQYIIELPDFILILAGKAGDLLRKAGIATEVCSMNLRQLMIKEYYRNSKAKAE
LHLPETDLKIAIKEAIDWFKNHNMT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttagttactggtgctaacggattattgggtcatcatgttgtatttgaatta
gtaaaacgtcaacttgatgtaagagttattgtcagaagtacagaaaatatttactttgat
gtggctaaaacagacgtatatgttggtaattttactgattatgaaagcctgaaacaagct
gctgcaggatgtgatgctatcatacacattgctgctgtaacggctactgatttgttgcat
tacgaggactacagcaagattaatgtggatggttcaagactgcttttaaaagtagccaat
gaattgaatattaataaaattgtttacgttagctctgccaataccattggattcggaact
gaacaagaacctgcggacgaatgttttaatattgaatttccatttacagaatcgtactat
gcgcaaagtaaagtagcttctgaaaaattgtttatagaagcttctaaaaagtccaatatg
cacgtggttattatcaacccgacgtttatgattgggtcgtacgataccaaacccagctca
ggcaaactgatgttgatgggttataaaaaaaggttgatgctaattcccaaaggtggtaaa
aattttgtttctgcacacgatgtagccgtttcggtttgtaatgcattggttgaaggccag
accggtgagcgttatttggcttctggaattaatctttcatttaaagaattctattcactt
caaatccaaattgaaaattataagcaatatattattgaattaccggattttatactaatt
ttggcaggtaaagcaggtgatttattacggaaagcgggaattgccactgaggtttgcagc
atgaatctgaggcaattgatgataaaagaatattaccggaatagtaaagcaaaagccgaa
ttacatttaccggaaacagatttaaaaatagccataaaagaagcaatagactggtttaaa
aatcacaatatgacgtaa

DBGET integrated database retrieval system