KEGG   Paludibacter propionicigenes: Palpr_2145Help
Entry
Palpr_2145        CDS       T01362                                 

Definition
heavy metal translocating p-type ATPase (EC:3.6.3.4)
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
ppn  Paludibacter propionicigenes
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2607939..2610227
Genome map
AA seq 762 aa AA seqDB search
MKTEKFDVTGMMCTACVSHVEKSVSKLDGVKNVNVNLLTNSLTVSFDELNLNTVAIEKSV
EEAGYEAHLRVDAANVTTGQEPKIDFVKLEQDEMKKRWWISFVFLLPLLYISMGHMLRLP
IPHTFHSTENALMVAFTQFLLTLPIVFVNKKYFQNGFKSLFKAAPNMDSLIAIGSSAAIL
YGIFAIYKIGYALGHADMQTAARFSEDLYFESGATILTLITLGKYLEAKSKNRTSNAITR
LMDLAPKTAVVIRNNEEVEIPVEQVLVGDVVVVRPGQRIPVDGIVESGSSSVDESALTGE
SIPVFKEKNDTVLSASINKSGFFTLRATKIGKDTTLSQIISLVEDASSSKAPISKLADRI
SAVFVPVVITISLLSIVVWLILGYPFDFALSIGIAVLVISCPCALGLATPVAIMVGTGKG
AEYGILIKSAESLEKAQKTDTIVLDKTGTITEGKPRVTDIFSSKSISDSELLIIAASLEK
LSEHPLAEAVLLEAENQKAEILPVKDFQAIPGQGVEGSMNGTKYLAGNHRLINNRGLDFQ
HFNALADKLADEGKTPLFIANQKEVLGIIAVSDTLKTTSKEAVERFRQMGMDVVMLTGDH
AKTAMAMQQQLNISTVIAEVLPQDKDKEITRLQAAGRNVAMVGDGINDAPALMRSDLGIA
IGAGTDVAIESADVVLMRSDLLDAVTTIRLSKAVMQNIKQNLFWAFFYNIIGIPLAAGVF
YSVLGWKLNPMFAAAAMSLSSVTVVLNALRLLRFKPSVENDK
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagaaaaattcgatgttaccggtatgatgtgcactgcatgtgtttcgcatgtt
gagaaaagtgtaagcaaactggacggagtaaaaaatgtcaatgtcaatttactgacaaac
agcttgaccgttagttttgacgaactgaatctcaataccgttgctatcgaaaaatcggtt
gaggaggctggttatgaagctcacctccgggttgatgcagctaatgttactaccggacaa
gaacctaagattgattttgtgaagttggaacaggatgaaatgaaaaagcgctggtggatt
tcttttgtttttctgttgccgttactctacatttccatggggcatatgctgcgactgccg
ataccacacacgtttcatagcaccgaaaatgcattgatggttgcattcactcagtttctg
ctcacattgcccatagtttttgtcaataagaaatattttcaaaacggatttaagtccttg
tttaaagctgctcccaacatggattcgttgattgcaatcggttcttcggcagcaattctg
tatggaattttcgcaatttataagataggctatgctctggggcatgccgatatgcaaacg
gccgcgagattttctgaagatttatactttgagtcgggtgccaccatactaacgcttata
acgttgggtaaataccttgaggctaaatcgaaaaaccgtacttcgaacgctattacacga
ttaatggatttagctccgaaaaccgccgtggtcatccgaaacaatgaagaagtggaaatt
ccggtggaacaggttttggtgggcgacgtggtagttgttcgtcccgggcaacgtattccg
gtggatggaattgtagaaagtggcagttcgtcagtcgacgaatcggctttaacaggtgaa
agcatccctgtttttaaagaaaaaaacgatacggtgctgtctgccagcatcaataaatct
ggattttttacattgagagcaacaaagataggaaaagatactacgctttcgcagattatc
agtttggtggaagatgcgtcatcttccaaagctcctatttctaaactggccgatagaata
agtgcggtttttgtaccggtggttattactatttctttgttgtcaatagtggtttggctt
atattgggttatccttttgattttgctttgtccataggcattgcagtattggttatttcc
tgtccctgtgcgttggggcttgccacaccggtggctatcatggtgggaacaggcaaagga
gctgaatatggtatcctgattaaatctgccgaatcgctggagaaggcgcaaaaaacagat
acaatagtactcgataaaaccggaacgattaccgaaggaaagcctcgcgtaacagatatt
tttagttcaaagtctatatcagactctgaattgttgatcattgcagcatcgctcgaaaaa
ctgtccgaacatcctttggcggaagctgttctgctagaagcagaaaaccaaaaagcagag
attctgcccgttaaagattttcaggctattcccgggcagggagtagaaggttcgatgaat
ggaacaaagtatttagcaggcaatcatagattgataaataatcggggactcgattttcag
cattttaatgcattggccgataaactggctgatgagggtaaaacgcctttgtttatagcc
aatcagaaagaggttttgggtattattgctgtttccgatacgcttaaaaccaccagcaaa
gaggctgttgaaagattcaggcagatgggtatggacgtggtaatgcttaccggtgatcat
gctaagactgctatggctatgcaacaacaattgaatatctccacagtaattgccgaggtg
cttccgcaagataaggataaagaaataacgcgactacaggctgccggaagaaatgtggcg
atggtgggcgatggtattaacgatgctccggcattgatgcgatccgacctaggcatagcc
attggggctggaaccgatgtggcaattgaatcggccgacgtagtgttgatgcgtagcgat
ttattggatgctgtcactactattcgactaagcaaagcggtaatgcagaatatcaagcag
aacttgttttgggcgttcttttataatatcattggtattccattggctgcaggtgtgttt
tatagtgtgctcggctggaagcttaatccaatgtttgcagctgcggctatgagtctaagt
tcagttacagtcgtattaaacgcacttcgcttattgcgctttaaacctagcgtagagaat
gataaataa

DBGET integrated database retrieval system