KEGG   Paludibacter propionicigenes: Palpr_2184Help
Entry
Palpr_2184        CDS       T01362                                 

Definition
uroporphyrinogen-iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppn  Paludibacter propionicigenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Palpr_2184
Enzymes [BR:ppn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Palpr_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2666590..2667348
Genome map
AA seq 252 aa AA seqDB search
MKIKRILVSQPRPTTEKSPYFDISEKYSVKIDFRPFIKVEPILAKEFRTQRITILDYTAI
IFNARHGIDHFFRLCEEMRITIPETMKYFCVSESVALYLQRYIHYRKRKVFYGATGKLAE
LVTIMNKHTDEKYLLITSDVQNEDTIATLEKLKVTYAKAVMYKTVSNDFGPDEEFNYDML
LFFSPIGIASLLKNFPNFEQGEIQIGCFGATTAQAVRDAGLRLDIEVPLPGVPSMTMALD
NFLKENNKKTRK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcaagaggatacttgtgtcgcaaccacggccgacaaccgaaaaatcaccctat
tttgacattagcgagaaatatagtgtcaagattgattttcgtccattcataaaggttgag
cctattttagcaaaagagttcagaactcaacgcataactattttagattatactgctatt
atctttaatgctcgtcatggtattgatcatttcttcagattgtgcgaagagatgcgtatc
actatacccgaaaccatgaagtatttctgtgtttccgagtcggtagcattgtatttacag
cgctatatacattatcgtaagcgcaaggttttttatggagctaccggaaaactggccgag
ttggtgaccattatgaacaaacacaccgatgagaaatatttacttattacctcggatgtg
caaaatgaagatactatcgctacgctggaaaaattaaaagttacttatgccaaagcggta
atgtacaaaacagtaagtaatgactttggtccggatgaagaatttaactacgatatgtta
ttgttctttagcccgattggaattgcttcacttctgaaaaacttcccgaattttgaacaa
ggagaaattcagataggatgctttggtgctaccactgctcaagcggtacgcgatgccgga
ctacgccttgatattgaagttccgcttccgggtgtgccttcaatgactatggcactggat
aactttttgaaagagaataataagaaaacacgaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system