KEGG   Paludibacter propionicigenes: Palpr_2306Help
Entry
Palpr_2306        CDS       T01362                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ppn  Paludibacter propionicigenes
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2801296..2802453
Genome map
AA seq 385 aa AA seqDB search
MKKQFLLTLNALLFSNFIFAANPVKDNLTLKDAYKDAFKIGCSVNNAIVQGSDFLSQQIV
LKQFNSLTPENVLKAETVNPRPGVWNFAQADAYVKFSEEHNMFTVGHTLVWHNQTPDWFF
KDDKGNPKSHEAMVEQLRSYIEKVAGRYTGRIKAWDVLNEQIDNDGSYRQTTWVKGIGGG
DELAKLAFKFANQYAPDAELYYNDFNVWRPAKRDGIARMIRMLKKEGIRIDGVGIQGHWG
LNYPKKEYIEAAIDTFATLGVKVMITELDVDVLPLTKEGQIIGQGMSDPQFQLEEFKTFL
DPYRNGLPAEVEKQLTDRYAELFGIFYKKRDKIDRVTVWGLHDGMSWKNDYPIPGRIDYP
LLFDRNKNPKPAFEAVLKVPKQKRP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcaatttttactaacgctaaatgcattacttttctctaactttatttttgca
gcaaatccggtaaaggacaatcttaccctgaaggatgcctataaagatgctttcaaaata
ggatgttcggtaaataatgccattgttcagggatctgattttttatcacaacaaatcgtt
ctgaaacagtttaattccctcacacccgaaaatgtgttgaaagccgaaacggtcaatccc
cgccctggagtttggaactttgcacaggccgatgcttatgtgaagttttcggaagagcac
aatatgtttaccgtaggtcatacgcttgtttggcacaaccagactcccgattggtttttc
aaagatgataagggaaaccctaaatcgcacgaagccatggtagaacaactcaggagttac
atagaaaaagtggccggaagatatacaggacgcattaaagcctgggatgtgttgaatgag
cagatagacaacgatggttcgtatcgccagactacctgggtaaaaggtattggcggtggt
gatgagttggctaagctggcttttaaatttgccaaccagtatgctcctgatgcagaattg
tattacaatgactttaatgtctggcgccctgccaagcgcgatggaatagcacgcatgata
cgtatgctcaaaaaagagggtattcgcattgatggtgtaggtattcagggacactggggg
ttgaattatcctaaaaaggaatatatcgaagcggctattgatacgtttgcaacattgggt
gttaaggttatgattaccgagctggatgtggatgtacttccgctaactaaagaaggacag
ataataggacaaggcatgagtgacccgcagtttcagttggaagaattcaagacatttttg
gatccttaccgaaacggacttcctgcagaagtagaaaagcaactaaccgatcgttatgct
gagttgttcgggattttttataaaaaacgtgataaaatagaccgtgttactgtttgggga
ctgcatgatggtatgtcatggaaaaacgattatccaataccgggtagaatagattatccg
ttgttgttcgacagaaacaagaatcctaaacccgcttttgaagctgttttaaaagttccg
aaacaaaagcgcccgtag

DBGET integrated database retrieval system