KEGG   Paludibacter propionicigenes: Palpr_2576Help
Entry
Palpr_2576        CDS       T01362                                 

Definition
uroporphyrin-iii c-methyltransferase
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
ppn  Paludibacter propionicigenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Palpr_2576
Enzymes [BR:ppn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Palpr_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3103375..3104142
Genome map
AA seq 255 aa AA seqDB search
MENELKSNITNINTLENQIKYGKVTLVGFGPGDPDLLTIAGEKALSKADVIFHDDLIDQD
FLGKYNGQKVYVGKRKHCHSHEQEEINQLILNSALEGNEVVRLKGGDSMIFAHGGEEVEF
LKKGGVQVSVIPGISTGIAVASLTQIPLTLRGIARSVAFITGHTSDVHLPNTDTLVCFMA
GSTIHKIAAKAIAEGRNPKTPVALVHNVSLPDQTEFLSTLEELAGSETVYPTPIIIVIGE
VISSRTGLAQTLELL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaattaaaaagcaatattacgaatataaatacacttgaaaatcagattaaa
tacggtaaggtgacactggttggttttggtcccggtgatcctgatttactgactattgca
ggagaaaaggcgttgtcaaaagcagatgtgatttttcacgacgacttgattgatcaggat
tttttgggtaaatacaatgggcaaaaagtgtacgttggtaaacgcaagcattgccacagt
cacgagcaggaggaaattaatcaactgattctgaattcggcgcttgaaggcaatgaagtg
gtgcgtctgaaaggtggtgactctatgatctttgctcacggaggtgaggaagtggagttc
cttaaaaagggtggcgtgcaggtgtcggtcatccccggaatttctaccggtattgctgtt
gcatcactcactcaaataccattaacgttgcggggcattgccagatcggtggctttcatt
actggtcatacttccgatgtccatttgcccaataccgacacgctggtatgttttatggcc
ggctctaccattcataaaattgctgctaaagccattgcagaaggccgcaatccgaaaact
ccggtggcattggtgcacaatgtgtctttgcccgatcaaactgaatttttgagcacactt
gaggaacttgctggcagcgaaactgtctatccaacacccattattatcgtaattggtgaa
gtgatttcgtcgcgcaccggacttgctcagaccttggaattgctgtaa

DBGET integrated database retrieval system