KEGG   Paludibacter propionicigenes: Palpr_2577Help
Entry
Palpr_2577        CDS       T01362                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppn  Paludibacter propionicigenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3104145..3105533)
Genome map
AA seq 462 aa AA seqDB search
MTQTTPQTTDVVIIGAGLTGLTTAYYLQKNQKEFLVFEKQTRIGGVIHSTRENGFLYENG
PNTGVVGNTAVVELFEELEQAGKCKPELAGKNVNKRFILKNAKWECMPLGPKDAITTPLF
SLWDKFRILGEPFRAKGKNPNESLASFVKRRMGQSFLDYAIDPFIGGVYAGDPNYLTTRF
AVPKIYNLEQNYGSLIGGSMKKPMKEKKTELEKRVNRKTFSMEGGLGNMTTALYESAGKD
KFVLGANNIQVQPTNGGFQVSYENGAGESLVIHAKKVISTTGAFVLEETMPFIEKDLLRK
IDSLIYTKVIEVALGFNRWEGIKLDGFGGLIPSKEKRDILGVLYMSSLFEGRAPELGALL
SVFLGGVRRQDLMLLNDEGVRQIVEKEFKALMGVNRFNPDFIKIIRHNHAIPQYGPDSAE
RFAAVEELEKMYPGLQIGGNLRGGIGMADRIKQGKELAQTAL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacaacacctcaaaccaccgatgtggtaataattggcgccggattaaccggc
ctgactactgcttattacctgcaaaagaatcagaaagaattccttgttttcgagaaacaa
acacgcattggtggcgtaatccactccacccgtgaaaacggtttcttgtacgaaaatggt
ccgaatacaggtgtggtaggcaataccgctgtggtggaacttttcgaagaactggagcaa
gccggaaaatgcaaacccgagctggcaggcaaaaacgtgaataagcgttttatcctgaaa
aatgccaaatgggaatgtatgccactcggtccgaaagatgctatcacaaccccactcttt
tcgctttgggataaattccgcattctgggtgagccctttcgtgctaaaggaaagaatccg
aacgaaagtctggcttcttttgtgaaacggcgtatggggcagagcttcctcgattatgcc
atcgatccgtttattggtggcgtgtatgccggcgatcccaattacttgactacgcgtttt
gctgtgccaaaaatatacaatctggagcaaaactatggtagcttgataggtggttcgatg
aagaaacccatgaaggaaaagaaaaccgaactggaaaaacgtgtaaaccggaagactttt
tcgatggaaggtgggttgggaaatatgactacagcgctttacgaatcggcaggaaaagat
aaattcgtgttgggagccaacaatattcaggtgcaaccaaccaatggaggctttcaggta
agctacgaaaatggtgcaggtgagtcccttgtgattcatgcaaaaaaagtaatatccact
accggagcatttgttcttgaagagactatgccgtttatagaaaaggatttgctgagaaaa
atcgattcattgatttacaccaaagttattgaagtggcactgggctttaatcgttgggaa
ggcattaaactggatggattcggcggactaattccttcgaaagaaaaacgtgatattctg
ggcgtgttgtatatgtcttcgttgttcgaaggcagagcgcctgagctaggcgctttactt
tcggtatttttgggtggtgttcgtcgtcaggatttgatgttgctcaacgatgaaggcgtt
cgacagattgttgaaaaagaatttaaagcgctgatgggtgtaaatcgttttaatcccgat
tttatcaaaatcatacgccataaccatgccattccgcaatatggtccggatagtgctgaa
cgttttgctgcggtagaggaactcgaaaagatgtacccgggactacaaattggcggtaac
ctccgcggtggtatcggtatggccgaccgcatcaaacaaggcaaagagctggcgcaaacc
gcgctttag

DBGET integrated database retrieval system