KEGG   Paludibacter propionicigenes: Palpr_2577Help
Entry
Palpr_2577        CDS       T01362                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00860  Porphyrin and chlorophyll metabolism
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Palpr_2577
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Palpr_2577
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Palpr_2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 Pyr_redox_3 Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox FAD_binding_3 NAD_binding_9 MCRA TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADQ80709
JGI: Palpr_2577
UniProt: E4T7L5
Position
complement(3104145..3105533)
Genome map
AA seq 462 aa AA seqDB search
MTQTTPQTTDVVIIGAGLTGLTTAYYLQKNQKEFLVFEKQTRIGGVIHSTRENGFLYENG
PNTGVVGNTAVVELFEELEQAGKCKPELAGKNVNKRFILKNAKWECMPLGPKDAITTPLF
SLWDKFRILGEPFRAKGKNPNESLASFVKRRMGQSFLDYAIDPFIGGVYAGDPNYLTTRF
AVPKIYNLEQNYGSLIGGSMKKPMKEKKTELEKRVNRKTFSMEGGLGNMTTALYESAGKD
KFVLGANNIQVQPTNGGFQVSYENGAGESLVIHAKKVISTTGAFVLEETMPFIEKDLLRK
IDSLIYTKVIEVALGFNRWEGIKLDGFGGLIPSKEKRDILGVLYMSSLFEGRAPELGALL
SVFLGGVRRQDLMLLNDEGVRQIVEKEFKALMGVNRFNPDFIKIIRHNHAIPQYGPDSAE
RFAAVEELEKMYPGLQIGGNLRGGIGMADRIKQGKELAQTAL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacaacacctcaaaccaccgatgtggtaataattggcgccggattaaccggc
ctgactactgcttattacctgcaaaagaatcagaaagaattccttgttttcgagaaacaa
acacgcattggtggcgtaatccactccacccgtgaaaacggtttcttgtacgaaaatggt
ccgaatacaggtgtggtaggcaataccgctgtggtggaacttttcgaagaactggagcaa
gccggaaaatgcaaacccgagctggcaggcaaaaacgtgaataagcgttttatcctgaaa
aatgccaaatgggaatgtatgccactcggtccgaaagatgctatcacaaccccactcttt
tcgctttgggataaattccgcattctgggtgagccctttcgtgctaaaggaaagaatccg
aacgaaagtctggcttcttttgtgaaacggcgtatggggcagagcttcctcgattatgcc
atcgatccgtttattggtggcgtgtatgccggcgatcccaattacttgactacgcgtttt
gctgtgccaaaaatatacaatctggagcaaaactatggtagcttgataggtggttcgatg
aagaaacccatgaaggaaaagaaaaccgaactggaaaaacgtgtaaaccggaagactttt
tcgatggaaggtgggttgggaaatatgactacagcgctttacgaatcggcaggaaaagat
aaattcgtgttgggagccaacaatattcaggtgcaaccaaccaatggaggctttcaggta
agctacgaaaatggtgcaggtgagtcccttgtgattcatgcaaaaaaagtaatatccact
accggagcatttgttcttgaagagactatgccgtttatagaaaaggatttgctgagaaaa
atcgattcattgatttacaccaaagttattgaagtggcactgggctttaatcgttgggaa
ggcattaaactggatggattcggcggactaattccttcgaaagaaaaacgtgatattctg
ggcgtgttgtatatgtcttcgttgttcgaaggcagagcgcctgagctaggcgctttactt
tcggtatttttgggtggtgttcgtcgtcaggatttgatgttgctcaacgatgaaggcgtt
cgacagattgttgaaaaagaatttaaagcgctgatgggtgtaaatcgttttaatcccgat
tttatcaaaatcatacgccataaccatgccattccgcaatatggtccggatagtgctgaa
cgttttgctgcggtagaggaactcgaaaagatgtacccgggactacaaattggcggtaac
ctccgcggtggtatcggtatggccgaccgcatcaaacaaggcaaagagctggcgcaaacc
gcgctttag

DBGET integrated database retrieval system