KEGG   Paludibacter propionicigenes: Palpr_2797Help
Entry
Palpr_2797        CDS       T01362                                 

Definition
hydroxymethylbutenyl pyrophosphate reductase (EC:1.17.1.2)
Orthology
K03527  
4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC:1.17.1.2]
Organism
ppn  Paludibacter propionicigenes
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Palpr_2797
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.2  4-hydroxy-3-methylbut-2-enyl diphosphate reductase
     Palpr_2797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3349633..3350514
Genome map
AA seq 293 aa AA seqDB search
MLNIEIDKKSGFCFGVVKAITKAEEELAKGETLYCLGDIVHNGQEVERLTKMGLITIDHE
QFALLHDAKVLLRAHGEPPKTYDIAKENNLTLIDASCPVVLKLQNRIKKAYQNAPSPDTQ
IVIYGEKGHAEVNGLVGQTDEKAIVIESEADLDKLDFNKKIQLFSQTTKSLEGFNELVIT
LSKKVQNNDNFEFFDTICRQVANRIPNITTFASQNDIVIFVSGKKSSNGKVLYQHSKKIN
PNTYLVTEANEVTGLDLDLTKQIGICGATSTPRWLMEEVADKLKEMSLSLERI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatatagaaattgataaaaaatcagggttttgtttcggagttgtaaaagctata
acaaaagctgaagaagaattagcaaaaggtgagacattatattgtttgggtgatatagtt
cataacggacaagaagtagaacgactcaccaagatggggctgataacgatagatcatgag
cagtttgccttactgcatgatgctaaagtgttgctcagagcgcacggtgaaccacccaaa
acttatgatatagcaaaggaaaacaatctgacgctaattgacgcatcgtgtcctgtggtt
ttgaaacttcaaaatcgtattaagaaagcttatcagaatgctccgtcgcccgatactcaa
atagtgatatacggcgaaaaaggccatgccgaagtgaatggccttgttggtcagacagat
gaaaaggccattgtgattgagagtgaagcagatttggataaattagactttaataaaaaa
attcagcttttttcacaaaccactaagtctctcgaaggttttaatgaattagtaataact
ttatcaaaaaaagttcaaaataatgacaattttgaatttttcgatacaatttgccgacaa
gttgcaaacagaattccaaatattactacctttgcaagtcaaaatgatatagtcattttc
gtaagcggaaaaaagagctcaaacggaaaggttttgtatcagcacagtaagaaaattaat
cctaatacttaccttgttaccgaagcaaatgaagtaaccgggctggatcttgatctgaca
aaacagattggaatatgtggagctacgtcaacaccccgttggttgatggaggaagtagcc
gataaattaaaggaaatgtcgttgagtttggaacgaatatag

DBGET integrated database retrieval system