KEGG   Paludibacter propionicigenes: Palpr_2839Help
Entry
Palpr_2839        CDS       T01362                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00900  Terpenoid backbone biosynthesis
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Palpr_2839
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Palpr_2839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADQ80968
JGI: Palpr_2839
UniProt: E4T8C4
Position
3396131..3397294
Genome map
AA seq 387 aa AA seqDB search
MSEIQKKQIAILGSTGSIGTQALEVLAHNDDLFEIYAITANNNVDLLIEQARKFQPEMVA
IGNEIHYQKLKKELSDLPIKVFAGIESIAQVAEMQPVDIVLTAMVGYSGLKPTINAIKAG
KKIALANKETLVVAGELICELALENNSAIIPVDSEHSAIFQCLAGEGNNPVEKLILTASG
GPFRTKSIHELETVTSAQALKHPNWDMGAKITIDSASMMNKGFEIIEAKWLFGVTPEQIQ
VVVHPQSIIHSMVQFADGSIKAQLGMPDMKLPIQYAFTYPERLKTNFPRFNFDLCSQFTF
EQPDLERFRNLAFAYYAMDKGGNMPCILNAANEIVVAEFLKDRIGFLQMSDIIENAMAKA
EFIAKPTYDDYVKTDALVRILTKELIK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaattcagaaaaaacaaatagctatattaggttcaacaggctctattgggact
caggcattggaagttcttgcgcacaatgatgatttattcgaaatttatgccattacagcc
aataataatgttgatttgctgattgagcaggcgcgaaaattccaaccggaaatggtggct
attggtaatgaaattcattatcagaagcttaaaaaagaattgtccgatctgcccattaaa
gtatttgcaggtatagagtctatagctcaggtggctgaaatgcagccggttgatatagtt
cttacagccatggttggttattcggggcttaaaccgactattaatgcgataaaggccggt
aagaaaatagcattggccaataaggaaacgcttgtggttgcgggtgaattgatttgtgaa
ctggctctggagaataattctgccattattccggttgattccgaacattcggcgatcttc
caatgtcttgcaggtgaaggaaataatccggtagagaaattaattcttacagcttcgggt
ggtccattcagaacgaaatccattcatgagttagaaactgtaaccagtgctcaggcttta
aagcatcccaactgggatatgggcgccaaaataacgatagattctgccagtatgatgaat
aaaggctttgaaatcattgaagccaagtggttatttggagttacaccggagcagattcag
gtggtggttcatcctcagtctattattcattcgatggttcagtttgccgatggttcaatt
aaagcacaacttggcatgccggatatgaagttgccgattcaatatgcatttacctatccg
gagaggttgaaaacgaattttccacgattcaattttgatttgtgctcgcagtttactttt
gagcaaccggatttggaaagatttagaaatctggcatttgcttattatgctatggataag
ggcggaaatatgccgtgcattcttaatgcggcaaatgaaattgtggtggccgaattttta
aaagatagaattggttttctacagatgagtgatatcattgaaaatgcaatggctaaagcc
gaatttattgctaaaccaacttacgatgattatgtgaagactgatgctttggtgagaata
ctcaccaaagagttgattaagtaa

DBGET integrated database retrieval system