KEGG   Paludibacter propionicigenes: Palpr_2894Help
Entry
Palpr_2894        CDS       T01362                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppn  Paludibacter propionicigenes
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppn01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3453324..3454166
Genome map
AA seq 280 aa AA seqDB search
MNNDKNIQDNSNSNSPLGVRGSNILDKIIASKKVEVAARNLSTPVSALEKSPVFSRKCLS
LKQSLLNSESGIISEFKRKSPSLGWIHEDADVVDVTSGYSAAGASGISILTDEEYFGGTP
MDLMAARQFIACPVLRKDFVIDEYQLYEAKAMGADVVLLIAAALTVQQTLELARKAHELG
LEVLLEVHNAEELGHANDYVDLLGVNNRNLKTFEQNIQTSFNLAALIPDQLVKVSESGIS
KGETVKELRKVGYKGFLMGENFMKEEDPAAALANFIENLQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgacaaaaacatacaagataatagtaactctaattcccctttaggggttagg
ggtagtaatatcttagataaaataatagcaagtaaaaaagttgaagtggcggctcgtaat
ctctcaacacctgtttcggctttagaaaagtctcctgttttttcccgtaaatgcttgtcg
ttgaagcaaagtttgctgaactcggaatcgggaattatttctgagtttaaacgtaaatcg
ccgtcactcggttggatacacgaagatgcggacgtggtggatgtaacttcgggttatagt
gcagccggagcctcaggtatttctattcttacggatgaagagtattttggcggtacgcca
atggatttgatggctgcccgtcagtttatagcttgtccggtgttgcgtaaggattttgtg
attgacgaatatcagctttacgaagccaaagccatgggggctgatgtggtgctgctgatt
gccgccgcgctcactgtgcaacaaacgcttgagcttgcccgcaaagcacatgaactcggg
ttggaagtattgcttgaagtacataatgccgaagaactcggtcatgccaacgactacgtg
gatttgttgggtgtcaacaaccgtaacctgaaaacttttgaacaaaacattcagacttcg
ttcaatttggcagcattgattccagatcagttagtgaaagtgagcgaaagcggcatctct
aagggggagaccgttaaggaattgcgaaaggtaggttacaaaggtttcctgatgggtgaa
aattttatgaaggaagaagatcctgcggcagcgctagcgaattttattgaaaatttacag
tag

DBGET integrated database retrieval system