KEGG   Paludibacter propionicigenes: Palpr_2896Help
Entry
Palpr_2896        CDS       T01362                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppn  Paludibacter propionicigenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Palpr_2896
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Palpr_2896
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Palpr_2896
Enzymes [BR:ppn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Palpr_2896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3454922..3455692
Genome map
AA seq 256 aa AA seqDB search
MNRINQLFEQKKENILSVYFTAGFPKLEDTLPTLKCLQANGVDLVEIGVPFSDPLADGIV
IQNSSQQALRNGMSIRKLFDQLTSVRADIHIPLIMMGYLNPIMQFGFETFCAECARVGVD
GMIIPDLPMVDYINQYKAIAERYGLEFIFLITPETSEERIREIDSHTNGFIYMVSSAAVT
GTQNSFDTKVDYFNRINSMNLKNPRLIGFGISNKSTRDMVNRYSSGAIIGSAFIKALEET
QDVEKGVKLLLDKLEE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcaatcaattattcgaacaaaagaaggaaaacatcctttcggtatatttt
actgccggttttccaaagctggaggacaccctgccaacactaaaatgccttcaggcaaat
ggtgtggatttggtggaaatcggagtgccattttccgatccgttggccgacggaattgtg
atacaaaacagcagtcagcaagctctacgaaacggtatgagcatccgcaagcttttcgac
caactcacatccgttcgggcagacattcatattccattaatcatgatgggctatctgaat
cccattatgcagtttggttttgagacgttttgtgccgaatgtgccagagtaggagtggac
ggtatgatcattcccgatctgcccatggtcgactacatcaaccaatacaaagccattgcc
gagcgctatggattggaatttattttccttattacgcccgaaacttcggaagaacgtatc
cgtgaaatcgacagtcataccaacggatttatctatatggtttcgtcggcagccgttaca
gggacgcaaaattcgttcgacacgaaggtagattactttaaccgcatcaactcgatgaac
ctgaaaaatccgcgcctgattggctttggaatctccaataaatcaacccgcgatatggtg
aaccgctattcttcaggagccattattggtagtgcttttatcaaagcacttgaagaaacg
caggatgtagagaaaggggtgaaactgctgttggacaaattggaagagtaa

DBGET integrated database retrieval system