KEGG   Paenibacillus polymyxa M1: PPM_0030Help
Entry
PPM_0030          CDS       T01968                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritolkinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPM_0030 (ispE)
Enzymes [BR:ppo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PPM_0030 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35135..35989
Genome map
AA seq 284 aa AA seqDB search
MKIYEKAPAKINLMLDVLRKRDDGYHEVEMIMTMVDLSDRLTMSELPRDTIIISSQAGYI
PLDEKNLAFQAARLIKERYNVSTGVHIHLDKHIPVAAGLAGGSSDAAAALRGLNKLWKLG
ISDAELRVLGAELGSDVPFCITGGTALASGRGELLKPLPNPPQCWVILAKPPINVSTAEV
YGRVKADQITHHPSARQMEQAIRNASFTDVCNTLGNVLEDVTLKLYPEVEHLKNSMIRLG
ADGVLMSGSGPTVFGLVSKEAKVPRIYNGLRGFCKDVYAVRLLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatatatgaaaaagcaccggcgaaaattaatttaatgcttgatgttctacgtaag
cgggacgatggttatcacgaggtcgaaatgattatgactatggtcgatctatccgaccga
ttgacgatgtccgagttaccgcgtgataccattattatttcaagccaagccgggtacata
ccgttagatgaaaagaacttggcttttcaggctgcgcgtctgatcaaagaacgttataac
gtgtctacaggcgtccatatccatctggataagcatatcccggtggctgcaggattagca
ggcggaagcagcgatgctgccgcagcattgcgtgggctgaacaagctgtggaaacttggt
atctcggatgcggaattaagggtactgggtgctgaattgggttcagacgtacctttctgt
attacagggggcacagctttagcgagcggacgtggagaactgcttaaaccactgccgaat
ccgccacaatgctgggtgatcctcgccaagccgccgattaatgtatcgacagctgaagtg
tatggtcgtgtcaaagcggatcagattacgcaccacccgtctgcccggcagatggagcag
gcgattcgtaatgcttcttttaccgatgtatgcaataccctggggaatgtactggaggat
gtgacattaaagctgtatccagaagtggagcatcttaaaaactccatgatccgtttagga
gctgatggggtgctgatgtcaggtagcggacctacagtgttcggactggtatcgaaggaa
gccaaagtgccacggatctataacggactaagaggcttttgcaaagatgtttacgcagta
cgacttttgacctga

DBGET integrated database retrieval system