KEGG   Paenibacillus polymyxa M1: PPM_0064Help
Entry
PPM_0064          CDS       T01968                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72351..73217
Genome map
AA seq 288 aa AA seqDB search
MNIPTLYQRSYQMGDAKLTLGHSTQIMGILNVTPDSFSDGGLHYNPEIAVLHALKLVEDG
ANIIDIGGESTRPGHEPVGVEEELARVIPVVQAIHRIAPDIPLSVDTYKAEVARQALEAG
AHIINDVWGFKADPDMARVAAEFDCPVILMHNRHDRNYSDLVSDMLSDLKESIQLALDAG
VRKEQIILDPGIGFAKDYDENIHAMTSLDTLSQLGFPLLLATSRKRFIRTALDLPVDDVV
EGTAATVAFGIAQGCQIVRVHDVAQIKRTVRMCDAMVYGAKNPLSYGG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaatataccaactctttatcaacgtagctaccaaatgggggatgccaagcttacactc
ggacactccacccagattatgggcatcctcaatgtgaccccggattctttttctgatgga
ggattacattataatccagagatagctgttttacatgcattgaaactagtggaagatgga
gcgaatatcattgacattggcggggagtctactcgtccgggccatgaaccagtaggtgtg
gaagaggaactggctcgggtcattccggtcgtccaggcgatccatcgtattgcaccggac
atcccattatctgtggatacttacaaagcagaagtagccaggcaggcgcttgaagcaggc
gcacacatcattaatgatgtgtggggctttaaggcagatcccgatatggcacgtgtagct
gcggaattcgattgtccggtcattttgatgcataatcgtcacgaccgtaactatagcgat
ttggtttctgatatgctgtccgatttaaaagaaagtatccaattggcgctggatgcaggg
gttcgtaaggagcagattattttagacccaggcatcggttttgccaaggattacgatgaa
aatatccatgctatgacttctctcgatacattgagtcagctggggtttccgctgttattg
gctacatcgcgcaaaagatttatccgtacagcactggatttgcctgtggatgatgtggtg
gagggaactgcggctaccgtggcctttggcattgctcaagggtgccaaattgtacgtgtg
cacgatgtggcacagatcaagcgcactgtacgtatgtgtgatgcgatggtgtacggggct
aaaaatccactgagttatggtgggtga

DBGET integrated database retrieval system