KEGG   Paenibacillus polymyxa M1: PPM_0066Help
Entry
PPM_0066          CDS       T01968                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73871..74419
Genome map
AA seq 182 aa AA seqDB search
MNAHSTSEASEAYIALGANLGEREHTLYEAITALDEHPAIRVVRCSSLYETEPVGYLDQP
SFLNMTVAVSTTLAPEELLFYMLEVESRLGRVRHIPNGPRTIDLDLLWMEAAQLATPDLE
LPHPRMLERAFVLVPLADIVPSQDSSGLYSIVHTALNSVDGKDGIQLWKTCSWRNDSAPF
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacattcgacctctgaggcatcagaggcttatattgctttaggggctaatttg
ggggagcgtgagcataccctgtatgaagccattaccgcactggacgaacatccggcgata
cgagtggtgcgctgctccagtctgtacgaaaccgagcctgttggatatctggatcagcct
tcttttttgaatatgacagtagccgtctctacaacacttgctccagaggagcttttgttt
tatatgctggaggtggagagtcgtctggggagggtaagacatattcctaacggtccacga
accattgatctggacttgttgtggatggaagcggcacaactggctacgccagatttggaa
cttcctcatcctcgtatgctggagcgtgcttttgtgctggttcctttggctgacattgtt
ccgagccaagattcgtccggtctgtacagtatcgtgcatacagcattgaattctgtggat
ggaaaggacggcatacagctttggaaaacttgcagctggcgcaacgactccgcgcctttc
ggaagctaa

DBGET integrated database retrieval system