KEGG   Paenibacillus polymyxa M1: PPM_0105Help
Entry
PPM_0105          CDS       T01968                                 

Gene name
gpmA1
Definition
(RefSeq) phosphoglycerate mutase family protein,putative (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPM_0105 (gpmA1)
   01230 Biosynthesis of amino acids
    PPM_0105 (gpmA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_0105 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    PPM_0105 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPM_0105 (gpmA1)
Enzymes [BR:ppo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPM_0105 (gpmA1)
Exosome [BR:ppo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPM_0105 (gpmA1)
  Exosomal proteins of melanoma cells
   PPM_0105 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
141122..141667
Genome map
AA seq 181 aa AA seqDB search
MKKIYFVRHAQATGQEPDARLTDEGKRQAEQLADFMENVGVEYIVSSPWKRAVRTIQPLA
ERRHLQVYTDLRLQERVLCRDHLDHWLDVLEQTYLDEDLKLEGGESSREAADRGIQLVQE
LIERAEKTVIIVTHGALLSLLIRHYDPQFGFEEWKKLSNPDVYLLELNEAEAKIHRVWNI
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaatttattttgttagacatgcccaagcaactggacaggaaccagatgcccga
ctcaccgatgaaggtaaacgacaagctgagcagttggctgattttatggagaatgtaggt
gtggaatatattgtgtccagtccatggaaacgggccgtgcgaaccattcagcccttggct
gagcgtagacatttgcaggtatatactgatctacgtcttcaggaacgtgtactatgccgt
gatcatctggatcattggctggacgtgctggaacagacatatctggacgaggacttgaag
ctggaaggaggagaatcatcccgtgaagcagcagatcgaggaatccagcttgttcaggag
cttatagagcgggcggaaaaaacggttatcattgtaactcatggagctttactctctctt
ctcattcgacattacgatccgcagtttggttttgaggagtggaaaaaactatccaatccc
gacgtgtatttgctagaactgaatgaagcagaagccaagattcacagagtgtggaatata
gattga

DBGET integrated database retrieval system