KEGG   Paenibacillus polymyxa M1: PPM_0134Help
Entry
PPM_0134          CDS       T01968                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171073..172326
Genome map
AA seq 417 aa AA seqDB search
MEKLMITGGRPLQGTVSISGAKNSAIALIPAAILAESEVILDNLPLLSDVAVYSEILEEL
GAKVAWEGSQMKIDPSSIKSIPMPNGPVKKLRASYYMMGAMLGRFKEAIIGLPGGCNFEP
RPIDQHIKGFEALGATVTNEHGAIHLHAKELRGTKIYLDVSSVGATINIMLAAARAKGAT
TIENAAKEPEIIDVATLLNSMGAIIKGAGTETIRIEGVSELHGCRHSIIPDRIQAGTYMI
AAAATRGNVLIDNVIPKHMEALTAKMQEMGIGIEEYDESIRVLGAPSYGHVDVKALVYPG
FPTDLQSPMTSLLTQAQGVSVLSDFVYSNRFKHVPELVRMGAKIRVEGRSAIIEGGQLNA
AKVKAADLRAGAALVIAGLTVSEGVTEVAGVEYIDRGYDHLVSNLRLLGADVWRQTE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgatgatcaccggtggacggccgcttcagggtacagtttccatcagcggt
gccaaaaacagtgccatcgccttgattcccgcagccattctggcagagtcggaagtcatt
ttggataatttgccgctgctcagtgatgtggcggtgtattccgagatattggaggagctt
ggcgcaaaggttgcctgggaaggtagccagatgaagatagacccttcctccattaaatcc
attcctatgccgaatggacctgttaagaaattacgagcctcttattatatgatgggggcc
atgctgggcagattcaaggaagcgatcatcggtttgccaggaggatgtaattttgaaccc
cggcccattgatcagcatatcaaaggttttgaggcgctgggtgccacggttacgaacgag
cacggcgctattcatttgcacgccaaagaactgcgcggcaccaagatttatttggatgtc
agcagcgtaggagcaaccattaatattatgctggcggccgcacgtgccaaaggcgccaca
actatcgaaaatgcggctaaagagcctgagattatagatgtagcaactctgttaaactcc
atgggggcgattattaaaggcgctggaacggagacgattcgtattgaaggtgtgtcggag
ctgcatggctgccgtcattccatcatacctgaccgtatacaagcaggcacatatatgatt
gctgctgcggcaacccgtggaaatgtattgattgacaatgtaatccccaaacatatggag
gctctcactgccaaaatgcaggaaatgggcatcggcatcgaggaatatgatgaaagtatt
cgcgtactgggtgcaccttcctatgggcatgtcgacgttaaagccttggtataccccggc
ttccccacggatttacaatctcccatgaccagcttgctaacccaggctcagggtgtcagt
gtgttgagcgattttgtgtacagcaatcgttttaagcacgtccctgaactggtgcgaatg
ggggctaaaattcgcgtagagggtcggtctgccattattgagggtggtcaactgaatgcg
gctaaagtgaaggctgcagatctgcgcgctggagcggcccttgtcattgctggacttaca
gtaagcgaaggggtaaccgaggtggcaggtgtcgagtatattgaccgtggttatgatcat
ctcgtttccaacctgcgtcttttgggcgcagatgtgtggcggcagactgagtaa

DBGET integrated database retrieval system