KEGG   Paenibacillus polymyxa M1: PPM_0172Help
Entry
PPM_0172          CDS       T01968                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPM_0172 (tpi)
   01230 Biosynthesis of amino acids
    PPM_0172 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_0172 (tpi)
   00051 Fructose and mannose metabolism
    PPM_0172 (tpi)
   00562 Inositol phosphate metabolism
    PPM_0172 (tpi)
Enzymes [BR:ppo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPM_0172 (tpi)
Exosome [BR:ppo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPM_0172 (tpi)
  Exosomal proteins of bladder cancer cells
   PPM_0172 (tpi)
  Exosomal proteins of melanoma cells
   PPM_0172 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
216088..216840
Genome map
AA seq 250 aa AA seqDB search
MRTPIIAGNWKMFKTVPEAKTFIEEIKGKAEVAGVESVICAPFTNLPALVEAVKGTSIKI
GAQNLHFAEDGAFTGEISGGMLKDLGVDYVVIGHSERREYFNETDETVNKKVHAAFRHGL
TPIVCVGEKLEDREAGQTKEVVKVQTVAAFAGLAKDQAAQVVVAYEPIWAIGTGKSSTSQ
DANEVISYIRSLIKELYDENTASAVRIQYGGSVKPENVTEYLGQSDIDGALVGGASLQPA
SYIALVEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacaccgattatcgcgggtaactggaagatgttcaaaaccgtaccagaagctaaa
accttcatcgaagagatcaaaggtaaagcagaggttgcaggagtggagagcgttatatgt
gctccatttacaaatcttcctgctctggttgaagcagtaaaaggcacatctattaaaatc
ggcgcacaaaacctgcactttgcagaagatggcgcatttacaggtgaaatcagcggcgga
atgcttaaagatctgggcgtagactacgttgtgatcggacactccgagcgtcgtgagtat
ttcaacgaaacagacgaaacggtgaacaaaaaggttcatgcagcattccgtcatggcctg
acaccaattgtatgtgtaggcgaaaagctggaagaccgtgaagcaggtcaaaccaaagaa
gttgtaaaagtgcaaactgtagcagcttttgctggtctggctaaagatcaagcagcacaa
gtcgtagttgcttatgagccaatctgggccatcggaacaggcaaatcctctacttcgcag
gatgcgaatgaagtgatttcctacatccgtagtctgattaaagagctgtatgatgaaaat
acagcaagtgctgtacgtattcagtacggtggtagtgtaaaacctgaaaatgttactgag
tacctgggtcaaagcgatatcgacggcgcgctcgtgggcggtgccagtcttcaaccggcg
tcgtacatcgcgcttgttgagggggcgaagtaa

DBGET integrated database retrieval system