KEGG   Paenibacillus polymyxa M1: PPM_0369Help
Entry
PPM_0369          CDS       T01968                                 

Gene name
glcK3
Definition
putative sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ppo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppo00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ppo00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451489..452430
Genome map
AA seq 313 aa AA seqDB search
MVVAVALNKVIGIDIGGTSVKAAIVARDGSVLDEIRMDTDASRGRDWVLSRVSDSVFGLM
CSFGDTSVSTPVGIGALGIATAGRVNVESGEVVYATDNLPGWQGTSLVRWAREKLALRAV
ADNDANAALLGEAWQGAGKGKQRLAMLTLGTGVGGAYMENGLLCRGAHWSGGDWGHSILF
PGGHPCNCGKKGCAEQYVSGSALLRRGSECTGKLYCSGNEIVEEAAHGNLKTIQALDDYT
ADLAVLLANISVTLDPELIIVGGGVADAGDVWWPLLEKHLDRLGVQTEVSRAMLGNRAGF
IGAARLAFEMTES
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggcagttgcattgaacaaagtcattgggatcgacattggagggacttctgta
aaggccgccatagtggcacgggatggatctgtacttgatgaaattcgaatggatacagat
gcctcccgtgggcgtgactgggtgttgtcgcgtgtatctgattctgtattcggactgatg
tgttcttttggggataccagtgtgagtacccctgtaggtataggcgctttaggtattgct
actgctggcagagtgaatgtggagagcggtgaagttgtgtacgctacagataacctacct
ggctggcagggtacatccttggtgaggtgggctagagaaaagcttgctttacgtgcggtt
gctgataatgatgcgaacgctgcgttacttggagaagcttggcagggggccgggaagggt
aagcagcgcctagccatgctcaccttgggaacaggggtcggaggcgcgtatatggaaaat
ggcctcttgtgtagaggtgctcattggagcggcggcgattgggggcacagtattttgttt
cctggaggtcacccctgcaattgcgggaaaaagggatgtgctgagcaatacgtatcaggt
agcgccctgttacgtcgaggtagtgaatgcaccggaaaactgtattgttctgggaacgag
attgtggaagaggccgctcacggcaacctgaagacaattcaggcgctagatgactacaca
gcagatttagctgttcttctggctaatatatcggtgactcttgatcctgagttgatcatt
gttgggggaggagtagcggacgcgggagatgtctggtggcccttgctggaaaagcatctg
gaccgactgggagttcaaacagaagtaagtcgggcaatgttaggaaaccgcgctggattc
attggcgctgccaggcttgcttttgagatgacggaatcttag

DBGET integrated database retrieval system