KEGG   Paenibacillus polymyxa M1: PPM_0644Help
Entry
PPM_0644          CDS       T01968                                 

Gene name
srfJ1
Definition
O-Glycosyl hydrolase family 30 (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppo00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(789343..790686)
Genome map
AA seq 447 aa AA seqDB search
MSNQTIQWFSTSKANAWKSQAHHLTETQESADLTLTGEAYQLVEGFGGCFNELSYVALNH
LDSEEREQVLHALFHPEGEHKFTICRLPIGASDYALEWYSHNETDGDMEMKHFSIERDQQ
YLIPFIREALQLNPDLKLFASPWSPPTWMKSPKAYNYGTLRWEKDILKAYALYFVKFVQA
YRKAGITIHQVHVQNEVIADQKFPSCVWTGEQLREFIRNYLGPAFEEHGLDTEIWLGTIN
APDPWEELMKKTSTGFDEYAHTVLSDPEAYKYIKGVGYQWAGKNAIQRTVASYPELRYMQ
TENECGNGENSWDYAKYVYNLYQHYFTNGVNAYIYWNMVLEPKGKSTWGWEQNSMITVDP
ANRKPILNPEYYVMKHFSHFVLPGARRIGIRGSWAGNAVAFQNTDGQKVLVIANPFKESR
VLNLSVGETTHRLELEPESFNTIVIPA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaccattcagtggttttccacttccaaagctaatgcttggaaatcccaa
gctcatcatttgaccgaaacccaagagagtgccgacctaacccttacgggagaagcatat
cagctcgtcgagggctttggcggctgttttaatgaattgagttatgtagctctgaatcat
ttggacagcgaagaacgagagcaggtgcttcatgctctctttcacccggagggcgagcac
aaattcacaatctgccgacttcctattggagcgagtgattacgcgctggaatggtacagc
cacaatgaaacggatggcgacatggagatgaagcacttttccattgagcgcgatcagcaa
tatctcataccttttattcgggaagcgttacaactcaatccagacttgaagctgttcgcc
tcaccctggagtccaccgacatggatgaaatcacccaaagcttacaattacggcacactg
cgctgggaaaaggatattttgaaagcgtatgcattgtactttgtcaaatttgttcaggca
taccgcaaggcaggcattacgattcaccaggttcatgttcaaaatgaagtcattgccgat
cagaagttcccttcctgtgtatggaccggagaacagctgcgtgaatttattcgcaactat
ttggggcccgcttttgaggaacatgggctggatacagagatttggctgggtaccattaac
gcccctgatccgtgggaggaattaatgaaaaagacgtcgaccggatttgatgagtatgcc
cacaccgtgttgagtgaccccgaggcctataaatatattaaaggggtaggctatcaatgg
gcaggcaaaaatgccattcagcgcactgtagccagctatcctgagcttcgttacatgcaa
accgaaaatgaatgcggaaacggagaaaactcatgggactacgccaaatacgtatataac
ctgtatcagcactatttcaccaatggtgtgaatgcttatatttactggaatatggttttg
gagccgaaaggcaagagcacatggggctgggagcaaaattcgatgatcaccgtggatcca
gcgaatcgaaaacctattctgaacccggaatattacgttatgaagcacttttctcatttt
gtattaccaggggccagacgcattggaattcggggttcatgggctggaaatgcggttgct
tttcaaaatacagacggacaaaaggttctggtcatcgccaacccgtttaaggaatctcgc
gtgctgaatctgtctgtcggagaaacaacacaccgtttggagctggagccggagtccttt
aacaccatcgttattcctgcttaa

DBGET integrated database retrieval system