KEGG   Paenibacillus polymyxa M1: PPM_0660Help
Entry
PPM_0660          CDS       T01968                                 

Gene name
lacZ3
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807464..809470
Genome map
AA seq 668 aa AA seqDB search
MKKLLYGVAYYDEYMPYDRLDQDIQMMKDAGINVVRIAESTWSTHEPQNGVFDFTSVDRV
LDAMHKAGIEVIVGTPTYAVPTWLVKEHPDVLATTPQGPGKYGARQIMDITNPVYLFHAE
RIIRKLIGRVSQHPAVIGFQTDNETKHYHTSGPNVQLQFVKYLRERFESLEELNRKFGLD
YWSNRINSWEDFPSVVGTINGSLGAAFSQFQRKLVTDFLAWQVAIVNEYKREDQFVTQNF
DFEWRGHSFGVQPDVDHFAASEAFDVTGVDIYHPSQDDLTGIEISFGGDVARSTKHNNYL
VLETEAQAFTHWVPYPGQLRLQAFSHLASGANMVAYWHWHSIHNSFETYWKGLLSHDFEP
NPVYEEAQTIGKDFARLSTHLVNLKKKNKTAILVSNEALTSINWFKFNMNSPLNYNDIVR
RLYDELYKLNIGTDIVHPGTESFDDYDLLIVPSLYSAPDALLEKLNRYVEQGGHVVYTSR
SGFTDEHVQVRTSQQPGVISEACGIHYSLFVEPKNVTLKDNPFKVAEDDNQVDTWMELIT
PTTAEVLAYYDHPHWGKYAAITQNRYGQGTATYIGCIVSSAVIRELFSSVAKKAGVWGLD
QEASYPIIVKSGTNDLGRTIRYYFNYSEQAGSVVYPHGDGKELIGEQSVTHGQLLQLKPW
SVIIIEEA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctattgtacggtgttgcttattatgatgaatatatgccttatgaccgtttg
gaccaagatatccaaatgatgaaggatgcaggaatcaatgtagtgcggatagccgaatct
acttggagtacgcatgaaccgcagaacggagtgtttgatttcacctccgtggatcgggtg
ctggacgccatgcataaggcgggtattgaggtcattgtgggcacgccgacctatgccgta
cccacatggctggtgaaggagcatcccgatgtcttggcgacaacacctcagggaccgggc
aaatacggggctcgtcagattatggacattacgaacccggtgtatctgttccatgctgag
cgaatcatacgcaagctgattggacgggtaagccagcatccggcagttattggctttcag
acagacaacgagacgaagcattaccatacgagtggtcccaatgtgcaattacagtttgtg
aagtatttgcgggagcggtttgaatcactggaggagctgaaccgcaaatttggactggat
tactggagcaatcgcatcaatagctgggaggacttcccttcggtggtcggaacgattaat
ggaagcttgggcgcggccttttcccagttccagcgcaagctggtgacggacttcctggcc
tggcaggtcgcgattgtcaatgaatataagcgggaagaccaatttgttacacaaaatttt
gattttgagtggagaggtcattcctttggagttcagccggacgtggatcactttgctgca
tctgaagcgtttgatgtgacgggtgtcgatatttaccatccatcacaagatgatttgact
ggaattgaaatctctttcggtggtgatgtggcacgttcgacaaaacataataattactta
gtgctggaaacggaggcgcaggcgtttacacactgggttccttatccgggacaattgcgt
ctgcaagcgttcagtcatctggcttccggggccaatatggtagcttactggcactggcat
tccattcataattccttcgaaacctactggaagggtctgcttagccatgattttgaaccg
aatcctgtgtatgaggaagcacagacgatagggaaggactttgcaagactgtccacgcat
ctggtcaatctgaaaaagaaaaataaaacagctatcctggttagcaacgaagcgttgaca
tccattaactggtttaagtttaatatgaacagcccactgaattacaatgacatcgtacgc
cgtctgtatgacgagctgtataagctgaatattgggacagatatcgtccatccgggtaca
gaatcgtttgatgactatgatctcttgatcgttccgagtctgtattctgcgccagatgca
ctgctggaaaagctgaaccgatatgtcgaacaaggtggtcatgtggtatacacgtcccgc
agcggatttaccgacgaacatgtgcaggtgagaacatcgcagcagccgggcgtgattagc
gaagcgtgtggtattcattacagcttgtttgtggagccgaaaaatgtgacactcaaggat
aatccttttaaagtggcagaagatgacaatcaggtagatacgtggatggagctgataacg
ccgacgactgccgaagtattagcctattacgatcacccgcattggggcaaatatgctgcg
attacgcaaaatcgctatggtcagggaacggcgacctacatcggctgtatcgtcagttcg
gcggtcatccgcgaattgttcagctctgtagccaaaaaggcaggcgtatggggactggat
caggaagcttcttatccgatcattgttaagtccggtacgaatgatttgggacgaacgatc
cggtactattttaactattccgaacaagcaggctcggtggtgtatccgcacggggacggc
aaggagctgatcggagagcagtcggttacccatggacaattgctccaattgaagccttgg
agtgttataattatcgaagaagcgtaa

DBGET integrated database retrieval system