KEGG   Paenibacillus polymyxa M1: PPM_0727Help
Entry
PPM_0727          CDS       T01968                                 

Gene name
melA3
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppo00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875523..877715
Genome map
AA seq 730 aa AA seqDB search
MAIIIDKEKLLFHLQGSNTSYVMQVIRDGYLAHLYWGKKIQNYRGSNKIIFMDRGFSPNP
DGADRAFSLDTIPQEYPSFGNSDFRIPAYQLQLENGSTVTDFRYKEHRVYQGKAKLKGLP
STYAEDDGEVETLEIILEDPLIDVKIVLSYSLYPKRDVITRSVRFDNEGQQQLKLLRALS
ASVDFRDDEYELITLYGAHNNEKNIARRKVLPGIQMVDSCRGASSPHQAPFMALVREGTD
EDQGEVYAFNLVYSGNFTAQTQVDSYRNTRVTMGINPFDFTWLLGPEESFQTPEVVMVYT
ENGLGGMSRIYHELYRNRLCRGPFRDKERPILINNWEATYFNFDADKIEQLAKEAQNVGV
ELFVLDDGWFGKRDDDNTSLGDWVVDRRKLPDGLPDLANRIRNLGMEFGLWFEPEMVSID
SDLYRRHPDWCIHVPDRPYTLGRNQLMLDLSRKEVCEYIVKSVSDILSNVPITYVKWDMN
RHMTDVGSAALPPERQRETAHRYILGLYSIMEELTSQFPHVLFESCSSGGGRFDAGMLYY
MPQTWTSDNTDAICRLKIQWGTSLVYPPITMGAHVSTVPNHQVGRITPLETRGYVAMAGN
LGYELDLTTLTVEEKEVVKKQIALYKEMRSLIQFGNFYRIINPFDENEAAWSFVSEDQTE
MAASYFKVLSQPAAAIKTLKFKGLNPDYIYRNIETGELFGGDELMHVGITLARVKQDFLG
MFWRFVKEDI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggctataatcatcgataaagagaagcttttattccatttacaaggcagcaataccagt
tatgtcatgcaggttatacgagatggttatttagcccatctgtattggggaaagaaaatt
cagaactatcggggaagcaataaaatcatctttatggatagagggttttcacccaatccg
gatggggcggatcgagctttttcactggataccatcccgcaagaatatccgtcatttgga
aatagtgatttcaggattcctgcgtatcagcttcaattggagaatggttctacagtgaca
gattttcggtataaagaacatcgggtttaccaaggcaaagcaaaattgaaagggcttcct
tctacgtatgcggaggatgatggcgaagtagaaacactggaaatcatccttgaagatcca
ttaattgatgtaaagattgtactatcctatagcctatatccaaagcgggatgtcattacc
cgttctgtccgttttgataatgaaggccagcagcagctaaaactgcttagagcgttaagt
gccagtgtggattttcgagatgatgagtatgaactcattaccttgtacggtgcgcataac
aatgaaaaaaatatagcaaggagaaaagttttacctggaattcaaatggtagacagctgc
cgtggcgccagtagccctcatcaggcaccctttatggcacttgtaagagaagggacagat
gaagatcagggcgaagtatacgcctttaatctggtgtacagcgggaactttacggcccag
acgcaggtagattcctatcggaacactagagtcacgatggggattaatccttttgatttc
acatggctgcttggaccggaggagtcgttccaaacgccggaagtggttatggtatacacc
gaaaatggcttgggcggcatgtcgagaatttatcatgaattatacaggaacagattatgt
cgtggaccatttcgtgacaaggaacggccgatcctgattaataactgggaagccacctac
tttaactttgatgccgacaagattgagcagttggcgaaggaagctcaaaatgtaggagtg
gagctgtttgtattggatgatgggtggtttgggaaacgagatgatgacaatacttcatta
ggcgattgggtggtggaccgtcgcaaacttccagatggattgccggatcttgccaatcgc
attcgaaatctgggtatggagtttggtttgtggtttgaacctgagatggtatccatagac
agtgatttatacagaaggcatcccgattggtgtatccatgtccctgatcgtccgtatacg
ctgggaagaaatcagcttatgttggatttatcaaggaaggaagtgtgtgagtacatcgtt
aagtcggtttccgatattttatcgaacgttccaattacttatgtaaaatgggacatgaat
cgtcacatgacagatgtgggttcggccgccttgccacctgagagacaaagggagacggcg
catcgttatatcctgggactctacagtattatggaagagcttacatcgcagtttcctcat
gtcttattcgaaagctgttctagtggaggaggccgttttgatgccggtatgctctattac
atgcctcagacctggacgagtgacaatacagatgccatttgccgactgaaaattcaatgg
gggacaagtcttgtctatcctccgattacgatgggcgcacacgtctccaccgtacccaac
catcaagtgggcagaataacaccattggagaccagaggttatgtcgctatggccgggaat
ttaggttatgagctggatttgacgacattaactgttgaagaaaaagaagttgtgaaaaag
cagatagctctatataaggaaatgagatcgctcattcagtttggaaacttttacagaatc
attaatccgtttgatgaaaatgaagccgcatggagctttgtgtcagaggatcaaacggaa
atggcggccagttatttcaaggttttatcccaaccggctgccgcgattaaaacgttaaaa
ttcaaaggtctgaatccagactacatttacagaaatatagaaactggtgagctgtttggc
ggtgatgaattaatgcatgtcggcataacgcttgccagggtaaaacaggattttctaggc
atgttctggaggtttgttaaagaagacatctga

DBGET integrated database retrieval system