KEGG   Paenibacillus polymyxa M1: PPM_0899Help
Entry
PPM_0899          CDS       T01968                                 

Gene name
srfJ3
Definition
O-Glycosyl hydrolase family 30 (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPM_0899 (srfJ3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPM_0899 (srfJ3)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PPM_0899 (srfJ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074801..1076318
Genome map
AA seq 505 aa AA seqDB search
MKKLPKQRRSDFFLLIVAAIILIGAILISLAMQNGVNTAGERNVSMWLTTPDPANRLTQQ
APIPWRKDNSNEVAANADTLTVEIRPDIRYQTMEGFGAAVSGSSAYLMNHGMSANQRDQL
LNDLFTAGGIQLSYIRHTIGASDYSVDEQGQPSNYTYDDVATGKDYELNHFSIAKDRDVI
DVLKQILRRNQDLWIMGTPWTAPPWMKYGEQIYNGWYLDYTDPRVYQAYADYFVRYIQAY
ANEGIPIQAISIQNEPEFTTSKYPSMSMGAVEQAKFIKQYLGPALSRNDLSTHIIAFDHN
WDTGSEYAKTVLGDEQARSYTHGTAFHCYKGEPTAMSDVHNAFPDKPVYMTECSGGAWSP
GFGDDLSWDMSKLIIGAPRNWSQNVLFWNIALDPSGGPTNGGCTNCRGVVTIDPLSGAVT
KNVEYYAIGHASKFVRPGAVRINSSHYSGSIETVAYRNPDGTLILIAANTGENTKTFKVR
QGNQVFKSTLPSKSAATFQWKPTTS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactcccaaaacaacgacgttctgacttcttcctgcttatagttgcagctatc
atcttgattggtgctattctgatcagtctagctatgcagaatggtgtgaacacggcaggc
gaaaggaatgtcagtatgtggctaaccacaccagacccggcgaatcgtctgacacagcaa
gccccaatcccatggagaaaagacaacagtaacgaagttgcagcgaatgcggatacactg
acggttgagattagaccagatattcgttaccagacgatggaagggtttggcgcagcagtt
tccggttcgtccgcatatctgatgaatcatggcatgtctgccaatcagcgtgatcagttg
ctcaatgacttgtttacagccggcggtattcaattaagctatattcgccataccattgga
gcatcagattattcagtggacgaacagggacagcctagcaactatacctacgatgatgtg
gcaacaggcaaggactatgagctaaatcatttttccattgccaaggatcgggatgtgatc
gatgtgctgaagcaaattctgagaagaaaccaggatttatggattatggggactccatgg
acggccccgccctggatgaaatatggtgagcagatatataacggttggtatttggactat
accgatccgcgtgtctatcaggcgtatgctgactattttgttcgttatatacaggcctat
gcgaatgaggggattcccattcaggcgatttccattcaaaatgagccggaattcaccacg
tccaagtatcccagcatgagtatgggagcagtagagcaggcgaaatttattaagcaatat
ttaggccctgctttaagtcgaaacgatttgtctacccatattattgcctttgaccataac
tgggatactgggagtgaatatgccaagaccgtactgggagacgaacaggctcgaagctat
acgcacggaacggcctttcattgctacaaaggagagccgacagcgatgtcagacgtgcac
aatgcttttccggataagcctgtttatatgacagaatgcagcggaggagcatggagtccg
ggctttggagatgatttaagctgggatatgtccaagctgattattggcgcaccccgaaac
tggtcgcaaaatgtcctcttttggaatattgcacttgacccgtccggcggtccgaccaat
ggtggatgtaccaactgtagaggtgtagtgaccatcgacccgttaagcggtgccgttacg
aaaaatgtagaatattatgcgattggacatgccagcaaatttgtccgtcctggtgcggta
cgtattaattcttctcattatagtggaagtattgaaacggtcgcttatcgtaaccccgat
ggtacgctgatcctgattgccgccaatacgggagagaacacaaagacatttaaggttcgg
caggggaatcaagttttcaaatcaacccttccatctaagtcagcagctacctttcaatgg
aagcctacaacttcctga

DBGET integrated database retrieval system